SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012706 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012706
Domain Number 1 Region: 282-424
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-40
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 178-283
Classification Level Classification E-value
Superfamily Second domain of FERM 3.53e-37
Family Second domain of FERM 0.00000422
Further Details:      
 
Domain Number 3 Region: 98-177
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.27e-27
Family First domain of FERM 0.0000842
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012706   Gene: ENSNLEG00000010403   Transcript: ENSNLET00000013332
Sequence length 880
Comment pep:novel supercontig:Nleu1.0:GL397356.1:7697023:7839411:1 gene:ENSNLEG00000010403 transcript:ENSNLET00000013332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTETGPDSEVKKAQEEAPQQPEAAAAVTIPVTPAGHGHPEAISNEKHPSQQDTRPAEQS
LDMEEKDYSEADGLSERTTPSKAQKSPQKIAKKYKSAICRVTLLDASEYECEVEKHGRGQ
VLFDLVCEHLNLLEKDYFGLTFCDADSQKNWLDPSKEIKKQIRSSPWNFAFTVKFYPPDP
AQLTEDITRYYLCLQLRADIITGRLPCSFVTHALLGSYAVQAELGDYDAEEHVGNYVSEL
RFAPNQTRELEERIMELHKTYRGMTPGEAEIHFLENAKKLSMYGVDLHHAKDSEGIDIML
GVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRSA
KRLWKVCIEHHTFFRLVSPEPPPKGFLVMGSKFRYSGRTQAQTRQASALIDRPAPFFERS
SSKRYTMSRSLDGAEFSRPASVSENHDAGPDSDKRDEDGESGGRRSEAEEGEVRTPTKIK
ELKPEQETTPRHKQEFLDKPEDVLLKHQASINELKRTLKEPNSKLIHRDRDWERERRLPS
SPASPSPKGTPEKASERAGLREGSEEKVKPPRPRAPESDTGDEDQDQERDTVFLKDNHLA
IERKCSSITVSSTSSLEAEVDFTVMGDYHGSAFEDFSRSLPELDRDKSDSDTEGLVFSRD
LNKGAPSQDDESGGIEDSPDRGACSTPDMPQFEPVKTETMTVSSLAIRKKIEPEAVLQTR
VSAMDNTQQVDGSASVGREFIATTPSITTETVSTTMENSLKSGKGAAAMIPGPQTVATEI
RSLSPIIGKDVLTSTYGATAETLSTSTTTHVTKTVKGGFSETRIEKRIIITGDEDVDQDQ
DLALAIKEAKLQHPDMLVTKAVVYTTDPSPEERDYKPQES
Download sequence
Identical sequences ENSNLEP00000012706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]