SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012724 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000012724
Domain Number - Region: 102-195
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0549
Family DBL homology domain (DH-domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012724   Gene: ENSNLEG00000010442   Transcript: ENSNLET00000013350
Sequence length 353
Comment pep:novel supercontig:Nleu1.0:GL397346.1:1717031:1745223:1 gene:ENSNLEG00000010442 transcript:ENSNLET00000013350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESIVQHLIHLCEEKH
ASLSDAALLDIIYTQFHQHQKVWDVFQMSKGPGEDVDLFDMKQFKNSFKKILQRALKNVT
VSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYSQTPYAFTSSSKLRRNTPLLGQALT
IASKHRQIVKMDLRSRYLDSLKAIVFKQYNQNFETHNSTTPLQERSLGLDINMDSRIIHE
NIVEKERVQRITQETFGDYPQPQLEFAQYKLETKFKSDLNGSILAEREEPLRCLIKFSSP
HLLEALKSLAPAALFCRIQKLLCYSGSHSQGTQDLSSWQKDLYLLFVPLYPRC
Download sequence
Identical sequences G1RHM3
ENSNLEP00000012724 XP_003272513.1.23891 ENSNLEP00000012724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]