SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012826 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012826
Domain Number 1 Region: 356-435
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000235
Family F-box domain 0.0045
Further Details:      
 
Domain Number 2 Region: 445-501,532-623
Classification Level Classification E-value
Superfamily RNI-like 0.000000151
Family Cyclin A/CDK2-associated p19, Skp2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012826   Gene: ENSNLEG00000010548   Transcript: ENSNLET00000013456
Sequence length 673
Comment pep:novel supercontig:Nleu1.0:GL397287.1:26918337:26931696:-1 gene:ENSNLEG00000010548 transcript:ENSNLET00000013456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LARLKIRALEKLEVDRRLERLSEEVEQKIAGQVGRLQAELERKAAELETARQESARLGRE
KEELEERASELSRQVDVSVELLASLKQDLVHKEQELSRKQQEVVQIDQFLKETAAREASA
KLRLQQFIEELLERADRAERQLQVISSSCGSTPSASLGRGGGGGGAGPNARGPGRMREHH
AGPAVPNTYAVSRHGSSPSTGASSRVPAASQSSGCYDSDSLELPRPEEGAPEDXXXXXXX
XXXXXXXXXXXXXXXPRSSGLRRQAIQNWQRRPRRHSTEGEEGDVSDVGSRTTESEAEGP
LDAPRPGPAMAGPLSSCRLSARPEGGSGRGRRAERGSPSRSNEVISPEILKMRAALFCIF
TYLDTRTLLHAAEVCRDWRFVARHPAVWTRVLLENARVCSKFLAMLAQWCTQAHSLTLQN
LKPRQRGKKESKEEYARSTRGCLEAGLESLLNAAGGNLLILRISTSKHLTDRSLWLASCY
CRALQAVTYRGVHRPVGHEVIWALGAGCREIVSLQVAPLHPCQQPTRFSNRCLQMIGRCW
PHLRALGVGGAGCGVQGLASLARNCMRLQVLELDHVSEITQEVAAEVCREGLKGLEMLVL
TATPVTPKALLHFNSICRNLKSIVVQIGIADYFKEPSSPEAQKLFEDMVTKLQALRRRPG
FSKILHIKVEGGC
Download sequence
Identical sequences ENSNLEP00000012826 ENSNLEP00000012826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]