SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012851 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012851
Domain Number 1 Region: 201-407,439-513
Classification Level Classification E-value
Superfamily RNI-like 1.96e-25
Family Rna1p (RanGAP1), N-terminal domain 0.085
Further Details:      
 
Domain Number 2 Region: 107-165
Classification Level Classification E-value
Superfamily F-box domain 0.00000000314
Family F-box domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012851   Gene: ENSNLEG00000010551   Transcript: ENSNLET00000013483
Sequence length 541
Comment pep:novel supercontig:Nleu1.0:GL397529.1:291614:294715:-1 gene:ENSNLEG00000010551 transcript:ENSNLET00000013483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPASRQVRRRARAAPRPRSAEDWWWDRLAPRGSGYHLLQSDSMLLVLSEPGPARPRAQ
RRAARRTPRQPPPGPRAAAKPRARLRPEPAPSPAAASAPAPMPTPEEGRNAGWGDRIPLE
ILVQIFGLLVASDGPIPFLGRAARVCRRWQEAASQPALWHTVTLSSPLVGQLAKGGVKAE
KKLLASLEWLMPSRFSQLQRLTLIHWKSQVHPVLKLVGECCPRLTFLKLSGCHGVTADAL
VMLAKACCRLHSLDLQHSMVESTAVVSFLEEAGSRIRKLWLTYSSQTTAILGALLGSCCP
QLQVLEVSTGINCNSIPLQLPVEALQRGCPQLQVLRLLNLMWLPKPPGRGAAPGPGFPSL
EELCLASSTCNFVSNEVLGRLLHGSPNLRLLDLRGCARITPAGLQDLPCRELEQLHLGLY
GTSDRLTLAKEGSPQLTQKWCHTLRELDLSGQGFSEKDLEQALAAFLSTPGGSHPALCSL
NLRGTRVTPSTVSSVISSCPGLLYLNLESCRCLRRGLKRVYRGLEEVQWCLEQLLTSPSR
S
Download sequence
Identical sequences ENSNLEP00000012851 ENSNLEP00000012851 XP_003281202.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]