SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012931 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012931
Domain Number 1 Region: 543-925
Classification Level Classification E-value
Superfamily RNI-like 1.1e-52
Family 28-residue LRR 0.00048
Further Details:      
 
Domain Number 2 Region: 4-94
Classification Level Classification E-value
Superfamily DEATH domain 3.77e-28
Family Pyrin domain, PYD 0.0062
Further Details:      
 
Domain Number 3 Region: 143-311
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000511
Family Nucleotide and nucleoside kinases 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012931   Gene: ENSNLEG00000010640   Transcript: ENSNLET00000013567
Sequence length 960
Comment pep:novel supercontig:Nleu1.0:GL397411.1:443836:474760:-1 gene:ENSNLEG00000010640 transcript:ENSNLET00000013567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESFFSDFGLLWYLKELRKEEFWKFKELLKQPLEKFELKPIPWAELKKASKEDVAKLLD
KHYPGKQAWEVTLNLFLQINRKDLWTKAQEEMRNKLNPYRKHMKEKFQLIWEKETCLHVP
VHFYKETMKNEYKELNDAYTAAARRRTVVLEGPDGIGKTTLLRKVMLDWAEGNLWKDRFT
FVFFLNVYEMNGIAETSLLELLSRDWPEPSEKIEDIFSQPERILFIMDGFEQLKFNLQLK
ADLSNDWRQRQPMPIILSSLLQKKMLPESSLLIALGKLAMQKHYFLLQHPKLIKLLGFTE
SEKKSYFSYFFGEKSKALKVINFVRDSGPLFILCHNPFICWLVCTCVKQRLERGEDLEIN
SQNTTSLYASFLTTVFKAGSQSFPPKVNRARLRSLCALAAEGIWTYTFVFSHGDLRRNGL
SESEGLMWVGMRLLQRRGDCFAFTHLCLQEFCAAVFYLLKRPKDDPNPAIGSVTQLVRAS
VVQPQTLLTQVGIFMFGISAEDIVNMLETSFGFPLSKDLKREITQCLEGVSQCEADREAI
GFQELFTGLFETQEKEFVTKVMNFFEEVFIYIGSIEHLVIASFCLKHCQHLTTLRMCMEN
IFPDDSGCISDYNEKLVYWRELCLVFITNKNFQMLDMENTSLDDASLAILCKALAQPVCK
LQKLIFTSVSNFGHDSELFKAVLHNPHLKLLSLYGTSLSQSDVRHLCETLKHPMCKIEED
VSLGCSCRVLFLSKVALQFDFLVFLRVFASAFISLVFHLLNLSLSRKVKVDSAGQGLFSE
CFRLLISNNGVASLCGALKHPGCSIRELWLMGCFLTSDSCKDIAAVLICNEKLKTLKLGH
NEIGDTGVRQLCAALKHPNCKLECLGLQTCPITHVCCGDLATALIACKTLRSLNLDWITL
DADAVVVLCEALSHPDCALQMLGNCQKSPGDTVAPGENHCSIHLLLTLPINTQPQLRLGK
Download sequence
Identical sequences ENSNLEP00000012931 ENSNLEP00000012931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]