SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012948 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012948
Domain Number 1 Region: 231-305
Classification Level Classification E-value
Superfamily Homeodomain-like 1.63e-26
Family Homeodomain 0.00072
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000012948
Domain Number - Region: 56-66
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00837
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 30-84
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0889
Family beta-sandwich domain of Sec23/24 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012948   Gene: ENSNLEG00000010647   Transcript: ENSNLET00000013583
Sequence length 348
Comment pep:novel supercontig:Nleu1.0:GL397414.1:358129:360290:-1 gene:ENSNLEG00000010647 transcript:ENSNLET00000013583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAFPPSLMMMQRPLGSSTAFSIDSLIGSPPQPSPGHFVYTGYPMFMPYRPVVLPPPPP
PPPALPQAALQPALPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSASPQHQE
AAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAEAVQASLVGAVRG
QGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEETPPSSGAAGS
TTSTGKNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRA
KWKRVKAGNANSKTGEPSRNPKIVVPIPVHVSRFAIRSQHQQLEQARP
Download sequence
Identical sequences A0A096N887 A0A2K5M8U4 A0A2K5RJ34 A0A2K5UYD4 A0A2K6CRE5 G1RI92 H2QJN8
ENSMMUP00000007770 ENSNLEP00000012948 XP_001082998.1.72884 XP_003277528.1.23891 XP_004033454.1.27298 XP_005574763.1.63531 XP_011726281.1.29376 XP_011899336.1.92194 XP_017393223.1.71028 XP_526072.2.37143 ENSPTRP00000022357 ENSGGOP00000005402 ENSGGOP00000018628 ENSMMUP00000007770 ENSPTRP00000022357 ENSPANP00000008813 9544.ENSMMUP00000007770 9598.ENSPTRP00000022357 ENSNLEP00000012948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]