SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013019 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013019
Domain Number 1 Region: 637-871
Classification Level Classification E-value
Superfamily RNI-like 2.06e-25
Family 28-residue LRR 0.0013
Further Details:      
 
Domain Number 2 Region: 15-107
Classification Level Classification E-value
Superfamily DEATH domain 1.41e-19
Family Pyrin domain, PYD 0.035
Further Details:      
 
Domain Number 3 Region: 209-316,343-408
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000214
Family G proteins 0.064
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000013019
Domain Number - Region: 534-586
Classification Level Classification E-value
Superfamily YbiA-like 0.0772
Family YbiA-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013019   Gene: ENSNLEG00000010718   Transcript: ENSNLET00000013656
Sequence length 871
Comment pep:novel supercontig:Nleu1.0:GL397411.1:633285:661909:-1 gene:ENSNLEG00000010718 transcript:ENSNLET00000013656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFSVTTCAGGDTIQGLLPYLMALDQYQLEEFKLCLEPRQLMDFWSAPQGHFPCIPWANL
RAADPLNLSFLLDEHFPKGQAWKVVLGIFQTMNLTSLCEKVTAKMKENVQTQELQDPTQE
DVEMLEAAAGNMQTQGCQDPNQEELEELEDETGNVQAQECQDPNQEEPEMLEEADHRRKY
REKMKAELLETWDNISWPKDHIYIRNTSKDEHEELQRLLDPNRTRAQAQTIVLVGSAGVG
KTTLAMQAMLHWASGVLFQQRFSYVFYLSCHKIRYMKETTFAELISLDWPDFDAPIEEFM
SQPEKLLFIIDGFEEILISESHSESLDDGSPCTDWYQELPVTKILHSLLKKELVPLATLL
ITIKTWFVTDLKASLVNPCFVQITGFTGEDLWVYFMRHFDDSSEVEKILQQIRKNETLFH
SCSAPMVCWTVCSCLKQPKVRYYDLQSITQTTTSLYACFFSNLFSTAEVDLADDSWPGQW
KALCSLAIEGLWSMNFTFNKVDTEIEGLEVPFIDSLYEFNILQKINDRGGCTTFTHLSFQ
EFFAAMSFVLEEPGEFLSHSTKPQEMKMLLRDVLLNKEDYWTSVVLFFFGLLNKNIAREL
EDTLHCKISPRVTEELLKWGEELGKAESASLQFHILQLFHCLRESQEEDFAKKMLGHIFE
VDLNILGDEELQASSFCLKHCKRLNKLRLSVSSHILERDLEILETSKVDSRMHAWNNICS
TLVTNENLHELDLSNSKLHASSVKGLCLALKNPRCKVQKLTCKSVTPEWVLQDLIIVLQG
NSKLTHLNFSSNKLGMTVPLILKALRHSDCNLKYLWVFGSLDLSRCRELANALRHNHNVK
ILDLGENDLKDDGVKLLCEALKPSPRALHTL
Download sequence
Identical sequences ENSNLEP00000013019 ENSNLEP00000013019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]