SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013036 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013036
Domain Number 1 Region: 609-1016
Classification Level Classification E-value
Superfamily RNI-like 1.96e-71
Family 28-residue LRR 0.000033
Further Details:      
 
Domain Number 2 Region: 37-122
Classification Level Classification E-value
Superfamily DEATH domain 1.65e-19
Family Pyrin domain, PYD 0.008
Further Details:      
 
Domain Number 3 Region: 182-311
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000965
Family RecA protein-like (ATPase-domain) 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013036   Gene: ENSNLEG00000010724   Transcript: ENSNLET00000013675
Sequence length 1025
Comment pep:novel supercontig:Nleu1.0:GL397411.1:677875:717193:1 gene:ENSNLEG00000010724 transcript:ENSNLET00000013675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDVNPPSDAPIPFSSSSTHSSHTPPWTFSCYPGSPCENGVMLYMRNVSNEDLQWFKQFL
LNELSAGTMPITWDQVETASWAEVVHLLIERFPGRRAWDVTSNIFAIMKCDKMCVLVHRE
INAILPTLEPEDLNVGETQVNLEEGESDKIWQYKLNVMEKYFPIRDTMTWPGNQRDFFYQ
DVHRHEEYFPCLLLPKRPQGRQPKTVVIQGAPGIGKTILAKKVMYEWARNKFYAHKPWCA
FYFHCQEVNQTTDQSFSELIEHKWPGSQDLVSKIMSKPDQLLLLLDGFEELTSTLIDRLE
DLSEDWRQKLPGSVLLSSLLSKTMLPEATLLIMIRFTSWQTCKPLLKCPSLVTLPGFNTM
EKIKYFQMYFGHTEEGDQVLSFAMENTILFSMCRVPVVCWMVCSGLKQQMERGNNLTQAC
PNATSVFVRYISSLFPTRAENFSRKIHQAQLEGLCHLAADSMWHRKWVLGKEDLEEAKLD
QTGVTAFLGMSVLRRIAGEEDHYAFTLVIFQEFFAALFYVLCFPQRLKNFHVLNHVNIQR
LIASPRGSKSYLSHMGVFLFGFLNEACASAVEQSFRCKVSFGNKRKLLKVIPLLHKCDPP
SPCGGVPQLFYCLHEIREEVFISQALNDYHKVVLRIGNNKEVQVSAFCLKRCQYLQEVEL
TVTLNFMNVWKLSSSSQPGSEAPESNGLHRWWQDLCSVFATNDKLEVLTMTNSVLGPPFL
KALAAALRHPQCKLQKLLLRRVNSTMLNQDLIGVLTGNQHLRYLEIQHVEVESKAVKLLS
RALRSPRCRLQCLRLENCLATPRIWTDLGNNLQGNRHLKTLILRKNSLEDCGAYYLSVAQ
LERLSIENCNLTQLTCESLASCLRQSKMLTHLSLAENALKDEGAKHIWNALPHLRCPLQR
LVLRKCDLTFNCCQDMISALCKNKTLKSLDLSFNSLKDDGVILLCEALKNPDCTLQILEL
ENCLFTSICCQAMASVLSKNQHLRHLDMSKNAIGVYGILTLCEAFSSQKKREEVIFCNPA
WTRVT
Download sequence
Identical sequences ENSNLEP00000013036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]