SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013044 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013044
Domain Number 1 Region: 803-1158
Classification Level Classification E-value
Superfamily RNI-like 1.44e-77
Family 28-residue LRR 0.00000425
Further Details:      
 
Domain Number 2 Region: 39-127
Classification Level Classification E-value
Superfamily DEATH domain 7.18e-25
Family Pyrin domain, PYD 0.018
Further Details:      
 
Domain Number 3 Region: 258-439
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000554
Family Extended AAA-ATPase domain 0.083
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000013044
Domain Number - Region: 703-832
Classification Level Classification E-value
Superfamily RNI-like 0.000275
Family 28-residue LRR 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013044   Gene: ENSNLEG00000010742   Transcript: ENSNLET00000013683
Sequence length 1178
Comment pep:novel supercontig:Nleu1.0:GL397411.1:730718:782820:1 gene:ENSNLEG00000010742 transcript:ENSNLET00000013683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLVTLSTGPTCSILPKNPLFPKNLSSQPCIKMEGDKSLTFSSYGLQWCLYELDKEEFQTF
KELLKKKSSESTTCSIPQFEIENANVECLALLLHEYYGASLAWATSISIFENMNLRTLSE
KARDDMKRHSPEDLEATTTDQGSSKEEVPEISQAMEQEGATAAETEEQEISQAMEQEGAT
AAETEEQEISQAMEQEGATAAETEEQGEENIYSLVALLEESWVEEISFLHSDLSLVSTPS
LQALDQYHGELCTFTVIIYMVLHGKSGIGKSALARRIVLRWAQGGLYQGMFSYVFFLPVR
EMQRKKESSVTEFISREWPDSQAPVTEIMSRPERLLFIIDGFDDLGSVLNNDTKLCKDWA
EKQPPFILLRSLLRKVLLPESFLIVTVRDVGIEKLKSEVVSPRYLLVRGISAEQRMHLLL
ERGIGEHQKTQGLRVIMNSRKLFDQCQVPAVGSLICVALQLQDVVGENVAPFNQTLTGLY
AAFVFHQLTPRGVVRRCLNLEERVVLKRFCRMAVEGVWNGKSVFDGDDLMVQGLGESELR
ALFHMNILLPDSHCEECYTFFHLSLQDFCAALYYVLEGLEIEPALCPLYVEKTKRSMELK
QAGFHIHSLWMKRFLFGLVSEDVRRPLEVLLGCPVPLGAKQKLLHWVSLLGQQPNATAPG
DTLDAFHCLFETQDREFVRLALNGFQEVWLPISQNLDLIAASFCLQHCPYLRKIRVDVKG
IFPRDESAEAWPVVPQWMWGKTLIEEQWEDFCSVLGTHPHLRQLDLGSSILTERAMKTLC
AKLRHHTCKIQTLMFRNAQITPGLQHLWRTLIANRNLRFLNLGGTHLKEEDVRMACEALK
HPKCLLESLRLDRCGLTHACYLKISQILTTSPSLKSLSLAGNKVTDQGVTALSDALKVSQ
CALQKLILEDCGITATGCQSLASALVSNRSLTHLCLSNNGLGNEGVNLLCRSMRLPHCSL
QRLMLNQCHLDTAGCGFLALALVANSWLTHLSLSMNPVEDNGVKLLCEIMREPSCHLQDL
ELVKCHLTAACCESLSCVVSRNRHLKSLDLTDNALGDGGVTALCQFCKMKNSGDRWLWLK
ACGLTSDCCEALSSALSCNRHLTSLNLVQNNFSPKGMMKLCSAFACPTSNLQIIGLWKWQ
YPVQIRKLLEEVQLLKPRIVIDGSCHFFNEDDRYWWKN
Download sequence
Identical sequences ENSNLEP00000013044 ENSNLEP00000013044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]