SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013055 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013055
Domain Number 1 Region: 774-953
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-41
Family DBL homology domain (DH-domain) 0.0000459
Further Details:      
 
Domain Number 2 Region: 963-1077
Classification Level Classification E-value
Superfamily PH domain-like 8.97e-34
Family Pleckstrin-homology domain (PH domain) 0.00049
Further Details:      
 
Domain Number 3 Region: 193-348
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000576
Family CRAL/TRIO domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013055   Gene: ENSNLEG00000010753   Transcript: ENSNLET00000013695
Sequence length 1215
Comment pep:novel supercontig:Nleu1.0:GL397290.1:89516:128834:1 gene:ENSNLEG00000010753 transcript:ENSNLET00000013695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALRNPMPLGSSEEAVGNSTCSSLAGASRDLGTGAAASGTQEETSGPRGDPQQTPSVEE
RHMPSRAGQGAAGRTFPRRSRSQERAPRSSGGAQAAACHTSHHSAGARPGGRLGGQAVGT
PNCVPVEGPGCTKEEDVLASSACVSTDGGSLHCHNPSGPSDVPAQQPHPEQEGWPPVTGG
FPSQVPKQVLDVNQELLQSGVVTLPGTRDRHGRAVVQVRTRSLPWTREHSSCAELTRLLL
YFHSIPRKEVRDLGLVVLVDARRSPAAPAVSQALAGLQNNTSIIHSILLLVDKESAFRPD
KDAVIQCEVVSSLKALHKFVDSCQLTADLDGSFPYSHGDWICFRQRLEHFAANCEEAVIF
LQNSFCSLNTHRTPRTAQEVTELIYQHETIMKLVLEDPLLVSLRLEGGTVLARLRREELG
TEDSRDTLEAATSLYDRVDEEVHRLVLASNNRLQQLERLQELASLLEGNDQQSCQKGLQL
AKENPQHTEEMVQDFRRGLSAVVSQAECREGELARWTRPSELCETVSSWMGPLDPEAYPS
SPVAECLRSCHQEATSVAAEAFPGAGVAVLKPHALGRPWASQQDLWLQCPQTRLHLEEAL
SEAARGPSTDTEGGAWEPTRPLSGLPGQALLCGQDGETLGPGLCAPWDPLSPLGGLPGAG
ATTAHLEDSSACSYEPTQALASRPRKHPQKKMIKKTQSFEIPQPDSGPRDSCQPSHTGVF
SKGLEVTSTVATEKKFPLQPRARSPPVTRSRSLSSPSGLHPAEEDGRQQVDSSRLRHIMA
EMIATEREYVRCLGYVIDNYFPEMERMDLPQGLRGKHHVIFGNLQKLHDFHQQHFLRELE
HCRHCPLAVGRSFLRHEEQFGMYVIYSKNKPQSNALLSSHGNAFFKDKQRELGDKMDLAS
YLLRPVQRVAKYALLLRDLLEEASRGLAQGQELGELRAAEVVVCFQLRHGNDLLAMDAIR
GCDVNLKEQGQLRCRDEFIVCCGRKKYLRHVFLFEDLILFSKTQKVEGGHDIYLYKQSFK
TAEIGMTENVGDTGLRFEIWFRRRRKFQDTYILQASSAEVKSAWTDVIGRILWQQALKSR
ELRIQEMASMGIGNQPFMDVKPGDQAPDCAVISELAPKCAVMGYRAPDSIVKGTESQMTG
STAVSSSDHAAPFKRPHSTISDSSTSSSSSQSSCILGSLGLLVSSSPAHPGLWSPALSPW
SSDIRACVKEDEPEP
Download sequence
Identical sequences ENSNLEP00000013055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]