SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013106 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013106
Domain Number 1 Region: 16-161
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.59e-106
Family Cyclophilin (peptidylprolyl isomerase) 0.00000601
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013106   Gene: ENSNLEG00000010779   Transcript: ENSNLET00000013748
Sequence length 166
Comment pep:novel supercontig:Nleu1.0:GL397405.1:511812:532960:-1 gene:ENSNLEG00000010779 transcript:ENSNLET00000013748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDF
MIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQ
WLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG
Download sequence
Identical sequences A0A024RCX8 A0A096NHT2 A0A1U7UA42 A0A287AFF5 A0A2I2U8T1 A0A2I3GBL8 A0A2K5E3L6 A0A2K5J895 A0A2K5L6H4 A0A2K5WSL3 A0A2K6AFC9 A0A2K6BXB1 A0A2K6FT87 A0A2K6K373 A0A2K6RUA0 A0A2K6TV36 E2RPE2 F7HVU8 G1THY5 G2HDU7 G3SAE4 G7MP64 H2PIW1 I3N787 L5L0K2 L8HUU0 L9KUH2 Q5E992 Q9Y3C6 S9W8S4
ENSPVAP00000013788 ENSTTRP00000002149 ENSP00000362803 ENSP00000362803 ENSNLEP00000013106 ENSTTRP00000002149 ENSPVAP00000013788 ENSPTRP00000030937 ENSBTAP00000003071 2x7k_A 5mqf_V 5xjc_S 5yzg_S 5z56_S 5z57_S 6ff4_V NP_001014869.1.59421 NP_001014869.1.76553 NP_001233365.1.37143 NP_057143.1.87134 NP_057143.1.92137 XP_001500057.1.31192 XP_002714719.1.1745 XP_002746528.1.60252 XP_003128416.1.46622 XP_003276951.1.23891 XP_003923266.1.74449 XP_003986118.1.62641 XP_004018834.1.66739 XP_004043974.1.27298 XP_004267709.1.21590 XP_004466905.1.11602 XP_004590383.1.84141 XP_004673486.1.23501 XP_005318809.1.77405 XP_005907791.1.15283 XP_006050478.1.26621 XP_006148694.1.99106 XP_006195357.1.101512 XP_006202122.1.17985 XP_006907379.1.64745 XP_007085314.1.5354 XP_007105435.1.24612 XP_007198016.1.59432 XP_007467338.1.90284 XP_007937595.1.48129 XP_007970960.1.81039 XP_008062771.1.4292 XP_008526984.1.77740 XP_008691601.1.72690 XP_010387999.1.97406 XP_010846972.1.44457 XP_011352838.1.92234 XP_011727602.1.29376 XP_011800708.1.43180 XP_011841998.1.47321 XP_011929985.1.92194 XP_011967295.1.54773 XP_012319739.1.9421 XP_012502042.1.63892 XP_012602297.1.48125 XP_013973878.1.84170 XP_014686461.1.49734 XP_014925291.1.86478 XP_014991743.1.72884 XP_015304280.1.63531 XP_015343145.1.40921 XP_016008141.1.101085 XP_016079224.1.3490 XP_017378072.1.71028 XP_017725608.1.44346 XP_019312499.1.44245 XP_019522974.1.44202 XP_019594385.1.88060 XP_019805374.1.83887 XP_019841738.1.53367 XP_020768212.1.74333 XP_020954313.1.46622 ENSCAFP00000002060 ENSFCAP00000001013 ENSFCAP00000001013 ENSOCUP00000016547 ENSOCUP00000016547 ENSPTRP00000030937 ENSCJAP00000029628 9598.ENSPTRP00000030937 9600.ENSPPYP00000018515 9606.ENSP00000362803 9615.ENSCAFP00000002060 9685.ENSFCAP00000001013 9823.ENSSSCP00000001703 9913.ENSBTAP00000003071 9986.ENSOCUP00000016547 ENSMICP00000009608 ENSP00000362803 ENSOPRP00000005553 ENSSTOP00000020233 ENSSSCP00000020580 ENSNLEP00000013106 ENSCJAP00000029628 ENSSTOP00000020233 ENSBTAP00000003071 ENSSSCP00000020580 ENSPPYP00000018515 ENSMICP00000009608 ENSPANP00000012530 ENSCAFP00000002060 gi|7706339|ref|NP_057143.1| ENSPPYP00000018515 ENSOPRP00000005553 d1xwna1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]