SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013297 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013297
Domain Number 1 Region: 17-289
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.01e-40
Family Rhodopsin-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013297   Gene: ENSNLEG00000010947   Transcript: ENSNLET00000013951
Sequence length 295
Comment pep:novel supercontig:Nleu1.0:GL397364.1:6671711:6685762:1 gene:ENSNLEG00000010947 transcript:ENSNLET00000013951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETSALPTGFGELEVLAVGMVLLVEALSGLSLNTLTIFSFCKTPELRTPCHLLVLSLAL
ADSGISLNALVAATSSLLRVSHRRWPYGSDGCQAHGFQGFVTALASICSSAAIAWGRYHH
YCTRSQLAWNSAISLVLFVWLSSAFWAALPLLGWGHYDYEPLGTCCTLDYSKGDRNFTSF
LFTMSFFNFAMPLFITITSYSLMEQKLGKSGHLQVNTTLPARTLLLGWGPYAILYLYAVI
ADVTSISPKLQMVPALIAKMVPTINAVNYALGNEMVCRGIWQCLSPQKSEKDRAK
Download sequence
Identical sequences G1RJ90
ENSNLEP00000013297 ENSNLEP00000013297 XP_012358358.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]