SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013329 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013329
Domain Number 1 Region: 199-344
Classification Level Classification E-value
Superfamily PH domain-like 1.7e-45
Family Third domain of FERM 0.00000026
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 1.7e-38
Family Second domain of FERM 0.000000602
Further Details:      
 
Domain Number 3 Region: 498-586
Classification Level Classification E-value
Superfamily Moesin tail domain 1.57e-31
Family Moesin tail domain 0.0000262
Further Details:      
 
Domain Number 4 Region: 5-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.96e-26
Family First domain of FERM 0.00000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013329   Gene: ENSNLEG00000010950   Transcript: ENSNLET00000013983
Sequence length 586
Comment pep:novel supercontig:Nleu1.0:GL397340.1:1567921:1620302:-1 gene:ENSNLEG00000010950 transcript:ENSNLET00000013983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPLPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQYMDNKGFPTWLK
LDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPE
TAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHR
GMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEEKTKK
AERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAE
LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEP
VSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQ
ARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL
Download sequence
Identical sequences ENSNLEP00000013329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]