SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013397 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013397
Domain Number 1 Region: 679-769,800-887
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 203-474
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.04e-33
Family FCH domain 0.06
Further Details:      
 
Domain Number 3 Region: 601-660
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000164
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013397   Gene: ENSNLEG00000010961   Transcript: ENSNLET00000014060
Sequence length 1261
Comment pep:novel supercontig:Nleu1.0:GL397278.1:26665638:26750447:-1 gene:ENSNLEG00000010961 transcript:ENSNLET00000014060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIAHKQKKTKKKRAWASGQLSTDVTSSEMGLKSLSSNSIFDPNYIKELVNDIRKFSHMLL
YLKEAIFSDCFKEVIHIRLEELLCVLKSVMNKHQNLNSIDLQNAAEMLTAKVKAVNFTEV
NEENKNDLFQEVFSSIETLAFTFGNILTNFLMGDVGNDSLLRLPVSRETKSFENVSVESV
DSSSEKGNFSPLELDNVLLKNTDSIELALSYAKTWSKYTKNIVSWVEKKLNLELESTRNM
VKLAEATRTNIGIQEFMPLQSLFTNALLNDIESSHLLQQTIAALQANKFVQPLLGRKNEM
EKQRKEIKELWKQEQNKMLEAENALKKAKLLCMQRQDEYEKAKSSMFRAEEEHLSSSGGL
AKNLNKQLEKKRRLEEEALQKVEEANELYKVCVTNVEERRNDLENTKREILTQLRTLVFQ
CDLTLKAVTVNLFHMQHLQAASLADSLQSLCDSAKLYDPGQEYSEFVKATNSTEEEKVDG
NVNKHLNSSQTSGFGPANSLEDVVRLPDSSNKIEEDRCSNSADTTGPSFIRSWTFGMFSD
SESTGGSSESRSLDSESISPGDFHRKLPRTPSSGTMSSADDLDEREPPSPSETGPNSLGT
FKKTLMSKAALTHKFRKLRSPTKCRDCEGIVVFQGVECEECLLVCHRKCLENLVIICGHQ
KLPGKVHLFGAEFTQVAKKEPDGIPFILKICASEIENRALCLQGIYRVSGNKIKTEKLCQ
ALENGMHLVDISEFSSHDICDVLKLYLRQLPEPFILFRLYKEFIDLAKEIQHVNEEQETK
KDSLEDKKWPNMCIEINRILLKSKDLLRQLPASNFNSLHFLIVHLKRVVDHAEENKMNSK
NLGVIFGPSLIRPRPTTAPITISSLAEYSNQARLVEFLITYSQKIFDGSLQPQDVMCGIG
VVDQGCFPKPLLSPEEREIERSVKSLFFSSKEDIHTSESESKIFERATSFEESERKQNVL
EKCDACLSDKAQLLLDQEIESAFQKIEDGKTPKPLSLKSDRSTNNVERHTPRTKIRPVSL
PVDRLLLASPSNERNGRNMGNVNLEKFCKNPAFEGVNRKDTATTVCSKFNGFDQQTLQKI
QDKQYEQNSLTAKTTMIMPSALQEKGVTTSLQISWDHPINATQTSKPYAEPVRSVREASE
RRSSDSYPLAPVRAPRTLQPQHWTTFYKPHAPTISIRGNEEKPVSPSAAVPPGTAHDPQG
LRVKSMPDPDKASACPGQATGQPKEDSEELGLPDGNPTCQRPKLKRMQQFEDLEDEIPQF
V
Download sequence
Identical sequences ENSNLEP00000013397 ENSNLEP00000013397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]