SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013542 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013542
Domain Number 1 Region: 104-307
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-56
Family DBL homology domain (DH-domain) 0.00025
Further Details:      
 
Domain Number 2 Region: 318-468
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-31
Family Pleckstrin-homology domain (PH domain) 0.005
Further Details:      
 
Domain Number 3 Region: 546-640
Classification Level Classification E-value
Superfamily PH domain-like 4.62e-20
Family Pleckstrin-homology domain (PH domain) 0.0019
Further Details:      
 
Domain Number 4 Region: 453-518
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.76e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013542   Gene: ENSNLEG00000011095   Transcript: ENSNLET00000014215
Sequence length 655
Comment pep:novel supercontig:Nleu1.0:GL397405.1:666685:690400:1 gene:ENSNLEG00000011095 transcript:ENSNLET00000014215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGASEEKLASVSNLVTVFENSRTPEAAPRGHRLEDAHHRPECSPPESPGPWEETNVGEA
VGSEPRTVSRRYLNSLKNKLSSGAWRKSCQPVTLSGLGTQEPEKKIVQELLETEQAYVAR
LHLLDQVFFQELLRTARSSKAFPEDVVRVIFSNISSIYQFHSQFFLPELQRRLDDWTANP
RIGDVIQKLAPFLKMYSEYVKNFERAAELLATWTDKSPLFQEVLTRIQSSEASGSLTLQH
HMLEPVQRIPRYELLLKEYVQKLPAQAPDRADAQKALDMIFSAAQHSNAAITEMERLQDL
WGVYQRLGLEDDIVDPSNTLLREGPVLKISFRRNDPMERYLFLFNNMLLYCVPRVIQVGA
QFQVRTRIDVAGMKVRELMDAEFPHSFLVSGKQRTLELQARSQEEMISWMQAFQAAIDQI
EKRNETFKAAAQGPEGDTQEQELQSEELGLRAPQWVRDKMVTMCMRCQEPFNALTRRRHH
CRACGYVVCARCSDYRAELKYYDNRPNQICLHCYTFLTVNVLPKAKEDKRRGILEKGSSA
MPDQSLMCSFLQLIGDKWGKSGPRGWCVIPRDDPLVLYVYAAPQDMRAHTSIPLLGYQVT
VGPQGDPRVFQLQQSGQLYTFKAETEELKGRWVKAMERAASGWSPSWPNDGDLSD
Download sequence
Identical sequences XP_003276955.1.23891 ENSNLEP00000013542 ENSNLEP00000013542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]