SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013837 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013837
Domain Number 1 Region: 1976-2210
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.02e-54
Family DBL homology domain (DH-domain) 0.0000416
Further Details:      
 
Domain Number 2 Region: 2210-2334
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-31
Family Pleckstrin-homology domain (PH domain) 0.003
Further Details:      
 
Domain Number 3 Region: 1784-1846
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000374
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.019
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000013837
Domain Number - Region: 153-225
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000529
Family Ankyrin repeat 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013837   Gene: ENSNLEG00000011353   Transcript: ENSNLET00000014519
Sequence length 2814
Comment pep:novel supercontig:Nleu1.0:GL397317.1:2797040:3168059:1 gene:ENSNLEG00000011353 transcript:ENSNLET00000014519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLNPQQAPLYGDCVVTVLLAEEDKVEDDVVFYLVFLGSTLRHCTSTRKVSSDTLETIAP
GHDCGETVKVQLCASKEGLPVFVVAEEDFHFVQDEAYDAAQFLATSAGNQQALNFTRFLD
QSGPPSGDVNSLDKKLVLAFRHLKLPAEWSVLGTDQSLHDAGPRETLMHFAVRLGLLRLT
WFLLQKPGGRGALSIHNQEGATPVSLALERGYHKLHQLLTEENAGEPDSWSSLSYEIPYG
DCSVRHHRELDIYTLTSESDSHHEHPFPGDSCTGHIFKLMNIQQQLMKTNLKQMDNLMPL
MTMAQDPSSAPETDGQFLPCAPEPMDPQRLSSSEETESTQCCPGSPVAQTESSCDLSSIV
EEENTDRSCRKKNKGVERKGEKVEPAPIVDSGTVSDQDNCLQSLPDCGVKGTEGLSSCGN
RNEETGTKSGMPTDQESLSSGDAMLQRDLVMEPGTAQYSSGGELGGISTTNVSTPETAGE
MEHGLMNPDATVQKNVLQGGESTKERFENSNIGTTGASDVXXXXXXXDKISVPNCAPAAS
SLDGKKPAESSLALSSEETSTEETAETETSRSHEESADAPVDQNSVVIPAAAKDKISDGL
EPYTLLAAGIGEAMSPSDLALLGLEENVMPHQNSETNSSHAQSQKGKSSPICSTTGDDKL
CADSACQQSTVTCSGDLVAKLCDNIVSEPESTTARQPSSQDPPSASHCEDPQANTVTSDP
VRDTQEQVDFCPFKVVDNKGQRKDVKLDKPLTNMLEGVSHPHPVVPKMEKELVPDQAVIS
DSTFSLANSPGSESVTKDDALSFVPSQKEKGTATPELHTATDCRDGPDGDSNEPDTQSLE
DRAAGLSTSSTAAELQRGMGNTSPTGLGGEHEGPAAPATPEALNIKGDTDSSLQSVGKTT
LALDSVLTEEGKLLVVSESSAAQEQDKDKAVTCSSIKESALSSGTLQEEQRTPPPGQDTL
QFHEKSISTDCAKDKALQLSNSPGAPSACLKAETEHNKEVAPQVSLLTQGGAAQSLVPPG
ASLATDSRQEALGAEHSSSALLPCLMPDGSDGSEALNCSQPSPLDVGVKNTQSQGKTSAC
EVSGNVTVDVTGVNALQGTAEPRRENISHNTQDILMPNVLLSQEKNAILSLPVALQDKAV
TDPQGVGTPEMIPLDWEKGKLEGADHSCTMGDAEEAQIDDEAHPVLQPAAKEFPTDMGLS
AHDDGAPAGVREVMRAPPSGSERSTPSLPCTVSAQAAPLPKGADLIEETASCIVDAVIEQ
VKAAGALLTEGEACHMSLSSPELGPLTEGLENAFTEKMSTFPPGESLPMGSTPEEATGSL
AGCFAGREEPEKIILPVQGPEPATEMPDVKAEDEVDFRASSISEEVAVGSIAATLKMKQG
PMTQAINRENWCTIEPCPDAASLLASKQSPECEDFLDVGLGRECTSKQGVLKRESGSDSD
LFHSPSDDMDSIIFTKPEEEQLACDITGSSSSTDDTASLDRHSSHGSDVSLSQILKPNRS
RDRQSLDGFYSHGMGAEGRESESEPADPGDVEEEEMDSITEVPANCSVLRSSMRSLSPFR
RHSWGPGKNAASDAEMNHRSMSWCPSGVQYSAGLSADFNYRSFSLEGLTGGAGIGNKPSS
SLEVSSANAKELRHPFSGEERIDSLVSLSEEDLESGQREHRMFDQQICHRPKQQGFNYCT
SAISSPLTKSISLMTISHPGLDNSRPFHSTFHNTSANLTESITEENYSLLPHSFSKKDSE
WKSGTKVSRTFSYIKNKMSSSKKSKEKEKEKDKIKEKEKDSKDKEKDKKTVNGHTFSSIP
VVGPISCSQCMKPFTNKDAYTCANCSAFVHKGCRESLASCAKVKMKQPKGSLQAHDTSSL
PTVIMRNKPSQPKERPRSAVLLVDETTATPIFANRRSQQNVSLSKSVSIQNIAGVGNDEN
MSNTWKFLSHSTDSLNKISKVNESTESLTDEGVGTDMNEGQLLGDFEIDSKQLEAESWSR
IIDTKFLKQQKKDVVKRQEVIYELMQTELHHVRTLKIMSDVYSRGMMTDLLFEQQMVEKL
FPCLDELISIHSQFFQRILERKESLVDKSEKNFLIKRIGDVLVNQFSGENAERLKKTYGK
FCGQHNQSVNYFKDLYAKDKRFQAFVKKKMSSSLVRRLGIPECILLVTQRITKYPVLFQR
ILQCTKDNEVEQEDLAQSLSLVKDVIGAVDSEVASYEKKVRLNEIYTKTDSKSIMRMKSG
QMFAKEDLKRKKLVRDGSVFLKNAAGRLKEVQAVLLTDILVFLQEKDQKYIFASLDQKST
VISLKKLIVREVAHEEKGLFLISMGMKDPEMVEVHASSKEERNSWIQIIQDTINTLNRDE
DEGIPSENEEEKKMLDTKARELKEQLQQKDQQILLLLEEKEMIFRDMAECSTPLPEDCSP
THSPRVLFRSNTEEALKGGPLMKSAINEVEILQGLVSGNLGGTLGPTVSSPIEQEGVVGP
VSLPRRAETFGGFDSHQMNASKGGEKEEGDDGQDLRRTESDSGLKKGGNANLVFMLKRNS
EVRTLTICRALLCVPPQGVVLQQDSYIEDQKLVLSERALTRSLSRPSSLIEQEKQRSLEK
QRQDLANLQKQQAQYLEEKRRREREWEARERELREREALLAQREEKVQQGQQDLEKEREE
LQQKKGTYQYDLERLRAAQKQLEREQEQLRREAERLSQRQTERDLCQVSHPHTKLMRIPS
FFPSPEEPHSPSAPSIAKSGSLDSELSVSPKRNSISRTHKDKGPFHILSSTIQTNKGPEG
QSQAPASTSASARLFGLTKPKEKKEKKKKNKTSRSQPGDGPMSEVSAEGEEIFC
Download sequence
Identical sequences ENSNLEP00000013837 ENSNLEP00000013837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]