SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013861 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013861
Domain Number 1 Region: 154-367
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.98e-53
Family DBL homology domain (DH-domain) 0.0000845
Further Details:      
 
Domain Number 2 Region: 381-500
Classification Level Classification E-value
Superfamily PH domain-like 2.39e-20
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013861   Gene: ENSNLEG00000011363   Transcript: ENSNLET00000014543
Sequence length 596
Comment pep:novel supercontig:Nleu1.0:GL397271.1:3853830:3899743:1 gene:ENSNLEG00000011363 transcript:ENSNLET00000014543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPELAAQKQPRPRRRSRRASGLSTEGATGPSADTSGPELNGRCSLRRGSSFTFLTPGPN
WDFTLKRKRREKDDDVVSLSSLDLKEPSNKRVRPLARVTSLANLISPVRNGAVRRFGQTI
QSFTLRGDHRSPASAQKFSSRSTVPTPAKRRSSALWSEMLDVTMKESLTTREIRRQEAIY
EMSRGEQDLIEDLKLARKAYHDPMLKLSIMSEEELTHIFGDLDSYIPLHEDLLTRIGEAT
KPDGTVEQIGHILVNWLPRLNAYRGYCSNQLAAKALLDQKKQDPRVQDFLQRCLESPFSR
KLDLWSFLDIPRSRLVKYPLLLKEILKHTPKEHPDVQLLEDAILIIQGVLSDINLKKGES
ECQYYIDKLEYLDEKQRDPRIEASKVLLCHGELRSKSGHKLYIFLFQDVLVLTRPVTRNE
RHSYQVYRQPIPVQELVLEDLQDGDVRMGGSFRGAFSNSEKAKNIFRIRFHDPSPGQSHT
LQANDVFHKQQWFNCIRAAIAPFQSAGSPPELQGLPELHEECEGNHPSVRKLTAQRRAST
VSSVTEVEVDENAYKCGSGMQMAEDSKSFKTHQTQPGIRRVRDKARSGGKRKETLV
Download sequence
Identical sequences G1RKV4
ENSNLEP00000013861 XP_003257648.1.23891 ENSNLEP00000013861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]