SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013938 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013938
Domain Number 1 Region: 23-67
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000971
Family RING finger domain, C3HC4 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013938   Gene: ENSNLEG00000011469   Transcript: ENSNLET00000014622
Sequence length 77
Comment pep:novel supercontig:Nleu1.0:GL397340.1:3759058:3768511:-1 gene:ENSNLEG00000011469 transcript:ENSNLET00000014622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAYRVDERAAEQARWEEATKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWN
CGCEWNRVCMGDHWFDM
Download sequence
Identical sequences ENSNLEP00000013938 ENSNLEP00000013938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]