SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014003 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014003
Domain Number 1 Region: 101-206
Classification Level Classification E-value
Superfamily Second domain of FERM 7.46e-37
Family Second domain of FERM 0.0000418
Further Details:      
 
Domain Number 2 Region: 204-351
Classification Level Classification E-value
Superfamily PH domain-like 9.22e-35
Family Third domain of FERM 0.00071
Further Details:      
 
Domain Number 3 Region: 9-100
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.89e-19
Family First domain of FERM 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014003   Gene: ENSNLEG00000011488   Transcript: ENSNLET00000014690
Sequence length 686
Comment pep:novel supercontig:Nleu1.0:GL397277.1:10856454:11148298:-1 gene:ENSNLEG00000011488 transcript:ENSNLET00000014690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCFCAVPEEFYCEVLLLDESKLTLTTQQQGIKKSTKGSVVLDHVFHHVNLVEIDYFGLR
YCDRSHQTYWLDPAKTLAEHKELINTGPPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVK
QDVLQGRLPCPINIAAQLGAYAIQSELGDYDPYKHTAGYVSEYRFVPDQKEELEEAIERI
HKTLMGQAPSEAELNYLRTAKSLEMYGVDLHPVYGENKSEYFLGLTPVGVVVYKNKKQVG
KYFWPRITKVHFKETQFELRVLGKDCNETSFFFEARSKTACKHLWKCSVEHHTFFRMPEN
ESNSLSRKLSKFGSIRYKHHYSGRTALQMSRDLSIQLPRPDQNVTRSRSKTYPKRIAQRQ
PAGSNSISRITANMENGENEGTTKIIAPSPVKSFKKAKNENSPDTQRSKSHAPWEENGPQ
SGLYSSPSDRTKSPKFPYTRRRNPSCGSDNDSLQPVRRRKARNSGEDSDLKQRRRSRSRC
NTSSGSESENSNREHRKKRNRIRQENDMVDSAPQWEAVLRRQKEKNQADPNNRRSRHRSR
SRSPDIQAKEELWKHIQKELVDPSGLSEEQLKEIPYTKIETQGDPIRIRHSHSPRSYRQY
RRSQCSDGERSVLSEVNSKTDLVPPLPVTRSLDAQGSGDATVHQRRNGSKDSLMEEKSQT
STNNLAGKHTAKTIKTIQVSRLKTET
Download sequence
Identical sequences G1RL96
ENSNLEP00000014003 ENSNLEP00000014003 XP_003259874.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]