SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014218 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014218
Domain Number 1 Region: 94-211,336-426,521-576
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000000412
Family Cyclin A/CDK2-associated p19, Skp2 0.015
Further Details:      
 
Domain Number 2 Region: 13-75
Classification Level Classification E-value
Superfamily F-box domain 0.0000000311
Family F-box domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014218   Gene: ENSNLEG00000011689   Transcript: ENSNLET00000014913
Sequence length 594
Comment pep:novel contig::ADFV01142987.1:37:5058:1 gene:ENSNLEG00000011689 transcript:ENSNLET00000014913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IASTQEDISNDDDDMHPAAAGMADGVHLLGFSDEILLHILSHVPSTDLILNVRRTCRKLA
ALCLDKSLIHTVLLQKDYQASEDKVRQLVKEIGREIQQLSMAGCYWLPGSTVEHVARCRS
LVKVNLSGCHLTSLRLSKMLSALQHLRSLAIDVSPGFDASQLSSECKATLSRVRELKQTL
FTPSYGVVPCCTSLEKLLLYFEILDRTREGAILSGQLMVGQSNVPHYQNLRVFYARLAPG
YINQEVVRLYLAVLSDRTPQNLHAFLISVPGSFAESGATKNLLDSMARNVALDALQLPKS
WLNGSSLLQHMKFNNPFYFSFSRCTLSGGHLIQQVINGGKDLRSLASLNLSGCVHCLSPD
SLLRKAEDDIDSSILETLVASCCNLRHLNLSAAHHHSSEGLGRHLCQLLARLHHLRSLSL
PVCSVADSAPRADRAPAQPAMHAVPRGFGKKVRVGVQSCPSPFSGQAGPQPSSVFWSLLK
NLPFLEHLELIGSNFSSAMPRNEPAIRNSLPPCSRAQSVGDSEVAAIGQLAFLRHLTLAQ
LPSVLTGSGLVSIGLQCQQLRSLSLANLGMMGKVVYMPALSDMLKHCKRLRDLR
Download sequence
Identical sequences ENSNLEP00000014218 ENSNLEP00000014218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]