SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014226 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014226
Domain Number 1 Region: 186-219
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000157
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000014226
Domain Number - Region: 9-102
Classification Level Classification E-value
Superfamily L-aspartase-like 0.0863
Family L-aspartase/fumarase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014226   Gene: ENSNLEG00000011677   Transcript: ENSNLET00000014923
Sequence length 266
Comment pep:novel supercontig:Nleu1.0:GL397283.1:1355106:1399467:1 gene:ENSNLEG00000011677 transcript:ENSNLET00000014923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGSTRRMGVMTDVHRRFLQLLMTHGVLEEWDVKRLQRHCYKVHDRNATVDKLEDFINNI
NSVLESLYIEIKRGVTEDDGRPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSE
TGFASSTNILNLVDQLKGKKMRKKEAEQVLQKFVQNKWLIEKEGEFTLHGRAILEMEQYI
RETYPDAVKICNICHSLLIQGQSCETCGIRMHLPCVAKYFQSNAEPHCPHCNDYWPHEIP
EVFDPEKERESGISKSNKKSLRSRQH
Download sequence
Identical sequences A0A2K5KYY9 G1RLW2
ENSNLEP00000014226 XP_003261624.1.23891 XP_003261625.1.23891 XP_011943155.1.92194 XP_011943164.1.92194 XP_011943169.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]