SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014346 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014346
Domain Number 1 Region: 377-683
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-96
Family Protein kinases, catalytic subunit 0.0000000000159
Further Details:      
 
Domain Number 2 Region: 2-123
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.14e-23
Family PLC-like (P variant) 0.0000366
Further Details:      
 
Domain Number 3 Region: 215-285
Classification Level Classification E-value
Superfamily Cysteine-rich domain 8.97e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00017
Further Details:      
 
Domain Number 4 Region: 143-211
Classification Level Classification E-value
Superfamily Cysteine-rich domain 7.33e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014346   Gene: ENSNLEG00000011735   Transcript: ENSNLET00000015055
Sequence length 706
Comment pep:novel supercontig:Nleu1.0:GL397271.1:4896384:5052660:-1 gene:ENSNLEG00000011735 transcript:ENSNLET00000015055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTF
DAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGKTEIWLELKPQGRMLMNAR
YFLEMSDTKDMSEFETEGFFALHQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFV
WGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYK
SPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQ
ARCLRDTEQIFREGPVEIGLPCSIKNEARPPCLPTPGKREPQGISWETPLDEVDKMCHLP
EPELNIERPSLQMKLKIEDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDD
DVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSR
ATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKTNTFC
GTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEDELFHSIRMDNPFYPR
WLEKEAKDILVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPYD
CSNFDKEFLNEKPRLSFADRALINSMDQNMFRNFSFMNPGMERLIS
Download sequence
Identical sequences G1RM82
ENSNLEP00000014346 ENSNLEP00000014346 XP_003257664.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]