SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014436 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014436
Domain Number 1 Region: 1787-1845
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000322
Family Canonical RBD 0.027
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000014436
Domain Number - Region: 75-134
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000811
Family beta-sandwich domain of Sec23/24 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014436   Gene: ENSNLEG00000011851   Transcript: ENSNLET00000015154
Sequence length 1953
Comment pep:novel supercontig:Nleu1.0:GL397283.1:3850045:3928560:-1 gene:ENSNLEG00000011851 transcript:ENSNLET00000015154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDLVQEEEQLMEEKKKKKDDKKKKEAAQKKATEQKIKVPEQIKPSVSQPQPANSNNGTST
ATSTNNNAKRATANNQQPQQQPQQQPQQQQQQQQQPQQQPQQQPPQPQPQQQPQQQPQAL
PRYPREVPPRFRHQEHKQLLKRGQHFPVIAANLGSAVKVLNSQSESSALTNQQPQNNGEV
QNSKNQSDINHSTSGSHYENPQRGPVSSTSDSSTNCKNAVVSDLSEKEAWPSVPGSDPEL
ASECMDADSASSSESEKNITIMASGNTGGEKDGLRNSTGLGSQNKFVVGSSSNNVGHGSS
TGPWGFSHGAIISTCQVSVDAPESKSESSNNRMNAWGTVSSSSNGGLNPSTLNSNSNHGA
WPVLENNGLALKGPVGCGSSGINIQCSTIGQMPNNQSINSKVSGGSTHGTWGSLQETCES
EVSGTQKVSFSGQPQNITTEMTGPNNTTNFMTSSLPNSGSVQNNELPSSNTGAWRVSTMN
HPQMQAPSGMNGTSLSHLSNGESKSGGSYGTTWGAYGSNYSGDKCSGPNGQANGDTVNAT
LMQPGVNGPMGTNFQVNTNKGGGVWESGAANSQSTSWGSGNGANSGGSRRGWGTPAQNTG
TNLPSVEWNKLPSNQHSNDSANGNGKTFTNGWKSTEEEDQGSATSQTNEQSSVWAKTGGT
VESDGSTESTGRLEEKGTGESQSRDRRKVDQHTLLQSIVNRTDLDPRVLSNSGWGQTPIK
QNTAWDTETSPRGERKTDNGTEAWGSSATQTFNSGACIDKTSPNSNDTSSVSGWGDPKPA
LRWGDSKGSNCQGGWEDDSAATGMVKSNQWGNCKEEKAAWNDSQKNKQGWGDGQKSSQGW
SVSASDNWGETSRSNHWGEANKKSSSGGSDSDRSVSGWNELGKTSSFTWGNNINPNNSSG
WDESSKPTPSQGWGDPPKSNQSLGWGDSSKPVSSPDWNKQQDIVGSWGIPPATGKPPGTG
WLGGPIPAPAKEEEPTGWEEPSPESIRRKMEIDDGTSAWGDPSKYNYKNVNMWNKNVPNG
NSRSDQQAQVHQLLTPASAISNKEASSGSGWGEPWGEPSTPATTVDNGTSAWGKPIDSGP
SWGEPIAAASSTSTWGSSSVGPQALSKSGPKSMQDGWCGDDMPLPGNRPTGWEEEEDVEI
GMWNSNSSQELNSSLNWPPYTKKMSSKGLSGKKRRRERGMMKGGNKQEEAWINPFVKQFS
NISFSRDSPEENVQSNKMDLSGGMLQDKRMEIDKHSLNIGDYNRTVGKGPGSRPQISKES
SMERNPYFDKDGIVADESQNMQFMSSQSMKLPPSNSALPNQALGSIAGLGMQNLNSVRQN
GNPSMFGVGNTAAQPRGMQQPPAQPLSSSQPNLRAQVPPPLLSPQVPVSLLKYAPNNGGL
NPLFGPQQVAMLNQLSQLNQLSQISQLQRLLAQQQRAQSQRSVPSGNRPQQDQQGRPLSV
QQQMMQQSRQLDPNLLVKQQTPPSQQQPLHQPVMKSFLDNVMPHTTPELQKGPSPINAFS
NFPIGLNSNLNVNMDMNSIKEPQSRLRKWTTVDSISVNTSLDQNSSKHGAISSGFRLEES
PFVPYDFMNSSTSPASPPGSIGDGWPRAKSPNGSSSVNWPPEFRPGEPWKGYPNIDPETD
PYVTPGSVINNLSINTVREVDHLRDRNSGSSSSLNTTLPSTSAWSSIRASNYNVPLSSTA
QSTSARNSDSKLTWSPGSVTNTSLAHELWKVPLPPKNITAPSRPPPGLTGQKPPLSTWDN
SPLRIGGGWGNSDARYTPGSFWGESISWIITNWFVLNTLLLMIDGSTLRTLCMQHGPLIT
FHLNLPHGNALVRYSSKEEVVKAQKSLHMCVLGNTTILAEFASEEEISRFFAQSQSLTPS
PGWQSLGSSQSRLGSLDCSHSFSSRTDLNHWNGAGLSGTNCGDLHGTSLWGTPHYSTSLW
GPPSSSDPRGISSPSPINAFLSVDHLGGGGESM
Download sequence
Identical sequences ENSNLEP00000014436 ENSNLEP00000014436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]