SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014509 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014509
Domain Number 1 Region: 338-645
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-87
Family Protein kinases, catalytic subunit 0.0000000199
Further Details:      
 
Domain Number 2 Region: 158-282
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.41e-35
Family Synaptotagmin-like (S variant) 0.00000177
Further Details:      
 
Domain Number 3 Region: 25-87
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.39e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0025
Further Details:      
 
Domain Number 4 Region: 98-154
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.05e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014509   Gene: ENSNLEG00000011923   Transcript: ENSNLET00000015230
Sequence length 673
Comment pep:novel supercontig:Nleu1.0:GL397283.1:4462289:4845699:-1 gene:ENSNLEG00000011923 transcript:ENSNLET00000015230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPATGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEE
LRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFS
FVNSEFLKPEVKS
Download sequence
Identical sequences A0A2I3HJQ3
ENSNLEP00000014509 XP_004087438.1.23891 ENSNLEP00000014509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]