SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014520 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014520
Domain Number 1 Region: 45-807
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.43e-263
Family Motor proteins 0.000000000258
Further Details:      
 
Domain Number 2 Region: 1223-1319
Classification Level Classification E-value
Superfamily PH domain-like 4.98e-27
Family Pleckstrin-homology domain (PH domain) 0.009
Further Details:      
 
Domain Number 3 Region: 1402-1521
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-21
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 
Domain Number 4 Region: 1804-1873,1916-1960
Classification Level Classification E-value
Superfamily Second domain of FERM 1.09e-17
Family Second domain of FERM 0.0085
Further Details:      
 
Domain Number 5 Region: 1339-1394
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000218
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 
Domain Number 6 Region: 1185-1223
Classification Level Classification E-value
Superfamily PH domain-like 0.000000181
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000014520
Domain Number - Region: 830-940,1225-1250
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000565
Family BAR domain 0.04
Further Details:      
 
Domain Number - Region: 1711-1797
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0214
Family Ras-binding domain, RBD 0.024
Further Details:      
 
Domain Number - Region: 1964-2050
Classification Level Classification E-value
Superfamily PH domain-like 0.0498
Family Third domain of FERM 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014520   Gene: ENSNLEG00000011899   Transcript: ENSNLET00000015242
Sequence length 2068
Comment pep:novel supercontig:Nleu1.0:GL397290.1:15915429:16192201:-1 gene:ENSNLEG00000011899 transcript:ENSNLET00000015242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNFFTEGTRVWLRENGQHFPSTVNSCAEGIVVFRTDYGQVFTYKQSTITHQKVTAMHPM
NEEGVDDMASLTELHGGSIMYNLFQRYKRNQIYTYIGSILASVNPYQPIAGLYEPATMEQ
YSRRHLGELPPHIFAIANECYRCLWKRHDNQCILISGESGAGKTESTKLILKFLSVISQQ
SLELSLKEKTSCVERAILESSPIMEAFGNAKTVYNNNSSRFGKFVQLNICQKGNIQGGRI
VDYLSSQNRVVRQNPGERNYHIFYALLAGLEHEEREEFYLSTPENYHYLNQSGCVEDKTI
SDQESFREVTTAMDVMQFSKEEVREVSRLLAGILHLGNIEFITAGGAQVPFKTALGRSAE
LLGLDPTQLTDALTQRSMFLRGEEILTPLNVQQAVDSRDSLAMALYACCFEWVIKKINSR
IKGNEDFKSIGILDIFGFENFEVNHFEQFNINYANEKLQEYFNKHIFSLEQLEYSREGLV
WEDIDWIDNGECLDLIEKKLGLLALINEESHFPQATDSTLLEKLHSQHANNHFYVKPRVA
VNNFGVKHYAGEVQYDVRGILEKNRDTFRDDLLNLLRESRFDFIYDLFEHVSSRNNQDTL
KCGSKHRRPTVSSQFKDSLHSLMATLSSSNPFFVRCIKPNMQKMPDQFDQAVVLNQLRYS
GMLETVRIRKAGYAVRRPFQDFYKRQEGAELDSLCYQRVLMRNLALPEDVRGKCTSLLQL
YDASNSEWQLGKTKVFLRESLEQKLEKRREEEVTHAAMVIRAHVLGFLARKQYRKVLYCV
VIIQKNYRAFLLRRRFLHLKKAAIVFQKQLRGQIARRVYRQLLAEKREQEEKKKQEEEEK
KKREEEERERERERREAELRAQQEEETRKQQELEALQKSQKEAELTRELEKQKENKQVEE
ILRLEKEIEDLQRMKEQQELSLTEASLQKLQERRDQELRRLEEEACRAAQEFLESLNFDE
IDECVRNIERSLSVGSEFSSELAESACEEKPNFNFSQPYPEEEVDEGFEADDDAFKDSPN
PSEHGHSDQRTSGIRTSDDSSEEDPYMNDTVVPTSPSADSTVLLAPSVQDSGSLHNSSSG
ESTYCMPQNAGDLPSPDGDYDYDQDDYEDGAITSGSSVTFSNSYGSQWSPDYRCSVGTYN
SSGAYRFSSEGAQSSFEDSEEDFDSRFDTDDELSYRRDSVYSCVTLPYFHSFLYMKGGLM
NSWKRRWCVLKDETFLWFRSKQEALKQGWLHKKGGGSSTLSRRNWKKRWFVLRQSKLMYF
ENDSEEKLKGTVEVRTAKEIIDNTTKENGIDIIMVDRTFHLIAESPEDASQWFSVLSQVH
ASTDQEIQEMHDEQANPQNAVGTLDVGLIDSVCASDSPDRPNSFVIITANRVLHCNADTP
EEMHHWITLLQRSKGDTRVEGQEFIVRGWLHKEVKNSPKMSSLKLKKRWFVLTHNSLDYY
KSSEKNALKLGTLVLNSLCSVVPPDEKIFKETGYWNVTVYGRKHCYRLYTKLLNEATRWS
SAIQNVTDTKAPIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPY
GDINLNLLKDKGYTTLSGTSSRFNFPAATESMSDPIPIIQGILQTGHDLRPLRDELYCQL
IKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQFPGTEMEKYAL
FTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLI
RGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSEVGDLPWKFYFKLYC
FLDTDNVPKDSVEFAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPP
LEEVYSLQRLKARISQSTKTFTPCERLEKRRTSFLEGTLRRSFRTGSVVRQKVEEEQMLD
MWIKEEVSSARASIIDKWKKFQGMNQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQE
LWLGVSADAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVA
KLMKAYISMIVKKRYSTTRSASSQGSSR
Download sequence
Identical sequences ENSNLEP00000014520 ENSNLEP00000014520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]