SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014725 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014725
Domain Number 1 Region: 390-613
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 8.94e-76
Family ATP sulfurylase catalytic domain 0.00000000702
Further Details:      
 
Domain Number 2 Region: 215-387
Classification Level Classification E-value
Superfamily PUA domain-like 9.25e-53
Family ATP sulfurylase N-terminal domain 0.000000429
Further Details:      
 
Domain Number 3 Region: 24-215
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.28e-36
Family Adenosine-5'phosphosulfate kinase (APS kinase) 0.00000087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014725   Gene: ENSNLEG00000012109   Transcript: ENSNLET00000015463
Sequence length 619
Comment pep:novel supercontig:Nleu1.0:GL397265.1:21020657:21114782:1 gene:ENSNLEG00000012109 transcript:ENSNLET00000015463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGIKKQKTENQQKSTNVVYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTISF
ALEEYLVSHAIPCYSLDGDNVRHGLNRNFGFSPGDREENIRRIAEVAKLFADAGLVCITS
FISPFAKDRENARKIHESAGLPFFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDS
DYEKPETPERVLKTNLSTVSDCVHQVVELLQEQNIVPYTIIKDIHELFVPENKLDHVRAE
AETLPSLSITKLDLQWVQVLSEGWATPLKGFMREKEYLQVMHFDTLLDGMFLLDGVINMS
IPIVLPVSAEDKTRLEGCSKFVLAHGGRRVAILRDAEFYEHRKEERCSRVWGTTCTKHPH
IKMVMESGDWLVGGDLQVLEKIRWNDGLDQYRLTPLELKQKCKEMNADAVFAFQLRNPVH
NGHALLMQDTRRRLLERGYKHPVLLLHPLGGWTKDDDVPLDWRMKQHAAVLEEGVLDPKS
TIVAIFPSPMLYAGPTEVQWHCRSRMIAGANFYIVGRDPAGMPHPETKKDLYEPTHGGKV
LSMAPGLTSVEIIPFRVAAYNKAKKAMDFYDPARHNEFDFISGTRMRKLAREGENPPDGF
MAPKAWKVLTDYYRSLEKN
Download sequence
Identical sequences ENSNLEP00000014725 ENSNLEP00000014725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]