SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014737 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014737
Domain Number 1 Region: 230-395
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 2.88e-70
Family A middle domain of Talin 1 0.0000003
Further Details:      
 
Domain Number 2 Region: 495-630
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.89e-53
Family I/LWEQ domain 0.00000199
Further Details:      
 
Domain Number 3 Region: 400-524
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.26e-51
Family I/LWEQ domain 0.00000478
Further Details:      
 
Domain Number 4 Region: 2035-2225
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.3e-51
Family I/LWEQ domain 0.00012
Further Details:      
 
Domain Number 5 Region: 1579-1713
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.43e-47
Family VBS domain 0.00000721
Further Details:      
 
Domain Number 6 Region: 966-1102
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.26e-41
Family VBS domain 0.028
Further Details:      
 
Domain Number 7 Region: 815-948
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.81e-29
Family VBS domain 0.012
Further Details:      
 
Domain Number 8 Region: 51-141
Classification Level Classification E-value
Superfamily PH domain-like 7.79e-25
Family Third domain of FERM 0.0000172
Further Details:      
 
Domain Number 9 Region: 1210-1296
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000128
Family I/LWEQ domain 0.0092
Further Details:      
 
Domain Number 10 Region: 2-50
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000183
Family Second domain of FERM 0.00022
Further Details:      
 
Domain Number 11 Region: 1745-1872
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000251
Family VBS domain 0.02
Further Details:      
 
Domain Number 12 Region: 1437-1555
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000152
Family VBS domain 0.063
Further Details:      
 
Domain Number 13 Region: 685-783
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000647
Family I/LWEQ domain 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000014737
Domain Number - Region: 1325-1400
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000298
Family VBS domain 0.041
Further Details:      
 
Domain Number - Region: 1847-1968
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0392
Family I/LWEQ domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014737   Gene: ENSNLEG00000012111   Transcript: ENSNLET00000015477
Sequence length 2281
Comment pep:novel supercontig:Nleu1.0:GL397307.1:6174455:6351462:1 gene:ENSNLEG00000012111 transcript:ENSNLET00000015477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEK
MKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQESYY
SVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQFNR
TGKAEHGSVALPAVMRSGSSGPETFNVGSMPSPQQQVMVGQMHRGHMPPLTSAQQALMGT
INTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVDESKHEIHSQVDAITAGTASVV
NLTAGDPADTDYTAVGCAITTISSNLTEMSKGVKLLAALMDDEVGSGEDLLRAARTLAGA
VSDLLKAVQPTSGEPRQTVLTAAGSIGQASGDLLRQIGENETDERFQDVLMSLAKAVANA
AAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIE
AGKLVDRSVENCVRACQAATTDSELLKQVSAAASVVSQALHDLLQHVRQFASRGEPIGRY
DQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLVNAMRSDAEAEIDMENSKKLLA
AAKLLADSTARMVEAAKGAAANPDNEDQQQRLREAAEGLRVATNAAAQNAIKKKIVNRLE
VAAKQAAAAATQTIAASQNAAVSNRNPAAQQQLVQSCKAVADHIPQLVQGVRGSQAQAED
LSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAMQLSQCAKNLATSLAELRTASQ
KAHEACGPMEIDSALNTVQTLKNELQDAKMAAVESQLKPLPGETLEKCAQDLGSTSKAVG
SSMAQLLTCAAQGNEHYTGVAARETAQALKTLAQAARGVAASTTDPAAAHAMLDSARDVM
EGSAMLIQEAKQALIAPGDAESQQRLAQVAKAVSHSLNNCVNCLPGQKDVDVALKSIGES
SKKLLVDSLPPSTKPFQEAQSELNQAAADLNQSAGEVVHATRGQSGELAAASGKFSDDFD
EFLDAGIEMAGQAQTKEDQIQVIGNLKNISMASSKLLLAAKSLSVDPGAPNAKNLLAAAA
RAVTESINQLITLCTQQAPGQKECDNALRELETVKGMLDNPNEPVSDLSYFDCIESVMEN
SKVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTEAAAQAAYLVGISDPNSQAGHQ
GLVDPIQFARANQAIQMACQNLVDPGSSPSQVLSAATIVAKHTSALCNACRIASSKTANP
VAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKCRIATAPLIEAVENLTAFASNP
EFVSIPAQISSEGSQAQEPILVSAKTMLESSSYLIRTARSLAINPKDPPTWSVLAGHSHT
VSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQASLAAVSQSLATRDDISVEALQ
EQLTSVVQEIGHLIDPIATAARGEAAQLGHKVTQLASYFEPLILAAVGVASKILDHQQQM
TVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASE
VGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVKYSKAIAVTAQEMMTKSVTNPE
ELGGLASQMTSDYGHLAFQGQMAAATAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQVC
PTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITAATAVSGIIADLDTTIMFAT
AGTLNAENSETFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQLAE
VVKLGAASLGSDDPETQVVLINAIKDVAKALSDLISATKGAASKPADDPSMYQLKGAAKV
MVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTVFQSKDVPEKTSSPEESIRMTK
GITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLTACKQASFHPDVSDEVRTRALRFG
TECTLGYLDLLEHVLVILQKPTPELKQQLAAFSKRVAGAVTELIQAAEAMKGTEWVDPED
PTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETLDFEEQILEAAKSIAAATSALV
KSASAAQRELVAQGKVGSIPANAADDGQWSQGLISAARMVAAATSSLCEAANASVQGHAS
EEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQAAGNAVKRASDNLVRAAQKAAFG
KADDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEARKKLAQIRQQQYKFLPTELREDE
G
Download sequence
Identical sequences ENSNLEP00000014737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]