SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014751 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014751
Domain Number 1 Region: 195-360
Classification Level Classification E-value
Superfamily RNI-like 2.67e-42
Family 28-residue LRR 0.00000628
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000014751
Domain Number - Region: 442-537
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00118
Family Formin homology 2 domain (FH2 domain) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014751   Gene: ENSNLEG00000012153   Transcript: ENSNLET00000015493
Sequence length 550
Comment pep:novel supercontig:Nleu1.0:GL397282.1:14228715:14236977:1 gene:ENSNLEG00000012153 transcript:ENSNLET00000015493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTFGYRRGLSKYESIDEDELLASLSAEELKELERELEDIEPDRNLPVGLRQKSLTEKTP
TGTFSREALMAYWEKESQKLLEKERLGESGKVSEDKEESEEELIFTESNSEVSEEVYTEE
EEEESQEEEEEEDSEEEERTIETAKGINGTVNYDSVNSDNSKPKIFKSQIENINLTNGSN
GRNTESPAAIHPCGNPTVIEDALDKIKSNDPDTTEVNLNNIENITTQTLTRFAEALKDNT
VVKTFSLANTHADDSAAMAIAEMLKVNQHITNVNVESNFITGKGILAIMRALQHNTVLTE
LRFHNQRHIMGSQVEMEIVKLLKENTTLLRLGYHFELPGPRMSMTSILTRNMDKQRQKRL
QEQKQQEGYDGGPNLRTKVWQRGTPSSSPYVSPRHSPWSSPKLSKKVQTVRSRPLSPVAT
PPPPPPPPPPPPPPPPSSQRLPPPPPPPPPPLPEKKLITRNIAEVIKQQESAQRALQNGQ
KKKKGKKVKKQPNNILKEIKNSLRSVQEKKMEDSSRPSTPQRSAHENLMEAIRGSSIKQL
KRVEVPEALR
Download sequence
Identical sequences G1RND7
ENSNLEP00000014751 ENSNLEP00000014751 XP_003261314.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]