SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014761 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014761
Domain Number 1 Region: 90-159
Classification Level Classification E-value
Superfamily RNI-like 0.000000334
Family Cyclin A/CDK2-associated p19, Skp2 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014761   Gene: ENSNLEG00000012162   Transcript: ENSNLET00000015503
Sequence length 227
Comment pep:novel supercontig:Nleu1.0:GL397312.1:927338:940236:1 gene:ENSNLEG00000012162 transcript:ENSNLET00000015503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRGSGAEACRNEDGYGGKGMKRVDYDRIRDVGPDRAASEWLLRCGAMVRYHGQERWQKD
YNHLPTGPLDKYKIQAIDATDSCIMRIGFDHMEGLEHVEKIRLCKCHYIEDDCLLRLSQL
ENLQKTILEMEIISCGNITDKGIIALRHLRNLKYLLLSDLPGAGNPGPCVASGSSRTRAP
LGFRERGLETDVPGALVDRPYDLSPSAGMRMLKLKATTAILKSRFQL
Download sequence
Identical sequences ENSNLEP00000014761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]