SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014804 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014804
Domain Number 1 Region: 884-1164
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-70
Family Protein kinases, catalytic subunit 0.00000863
Further Details:      
 
Domain Number 2 Region: 576-877
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.03e-29
Family Protein kinases, catalytic subunit 0.00041
Further Details:      
 
Domain Number 3 Region: 452-553,582-607
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000225
Family SH2 domain 0.0058
Further Details:      
 
Domain Number 4 Region: 375-437
Classification Level Classification E-value
Superfamily PH domain-like 0.000000467
Family Third domain of FERM 0.022
Further Details:      
 
Domain Number 5 Region: 141-266
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000607
Family Second domain of FERM 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014804   Gene: ENSNLEG00000012193   Transcript: ENSNLET00000015548
Sequence length 1185
Comment pep:novel supercontig:Nleu1.0:GL397381.1:1673775:1698017:-1 gene:ENSNLEG00000012193 transcript:ENSNLET00000015548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLRHWGTARGSKPVGDGAQPMAAMGGLKVLLHWAGPGGGEPWVTFSESSLTAEEVCIHI
AHKVGITPPCFNLFALFDAQAQVWLPPNHILEIPRDASLMLYFRIRFYFRNWHGMNPQEP
AVYRCGPPGTEASSDHTAQGMQLLDPASFEYLFEQGKHEFVNDVASLWELSSEEEIHHFK
NESLGMAFLHLCHLALRHGIPLEEVAKKTSFKDCIPRSFRRHIRQHSALTRLRLRNVFRR
FLRDFQPGRLSQQMVMVKYLATLERLAPRFGTERVPVCHLRLLAQAEGEPCYIRDSGEAP
TDPGPESAAGPPTHEVLVTGTGGIQWWPVQEEVNKEEASSGSSGRNLQASLSGKKAKAHK
AVGQPADRPQEPLWAYFCDFRDITHVVLKERSVSIHRQDNKCLELSLPSRAAALSFVSLV
DGYFRLTADSSHYLCHEVAPPRLVMSIRDGIHGPLLEPFVQAKLRPEDGLYLIHWSTSHP
YRLILTVAQRSQAPDGMQSLRLRKFPIEQQNGAFVLEGWGRSFPSVRELGAALQGCLLRA
GDDCFSLRRCCLPQPGETSNLIIMRGARASTRTFNLSQLSFHRVDQKEITQLSHLGQGTR
TNVYEGRLRVEGSGDPEEGKMDDEDPLVPGRDRGQELRVVLKVLDPSHHDIALALYETAS
LMSQVSHAHLAFVHGVCVRDPAVVMCTSAVSHVCATILQPERQSLGLASVPLLSGHTPSP
AHLENKNLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVSLGALSREERVERIPWMAPE
CLPGGPNSLSTAMDKWGFGATLLEICFDGEAPLQSRNPSEKEHFYQRQHRLPEPSCPELA
TLTSQCLTYEPTQRPSFRTILRDLTRLQPHNLADILTVNPDSLASDPTVFHKRYLKKIRD
LGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRLGWKQEIDILRTLYHEHIVKY
KGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSVGLAQLLLFAQQICEGMAYLHAQHYIHR
DLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYAS
DVWSFGVTLYELLTHCDSSQSPPTKFLELIGVAQGQMTVLRLTELLERGERLPRPNKCPC
EVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC
Download sequence
Identical sequences ENSNLEP00000014804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]