SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014928 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014928
Domain Number 1 Region: 216-452
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.45e-56
Family DBL homology domain (DH-domain) 0.0000387
Further Details:      
 
Domain Number 2 Region: 452-573
Classification Level Classification E-value
Superfamily PH domain-like 1.07e-31
Family Pleckstrin-homology domain (PH domain) 0.00069
Further Details:      
 
Domain Number 3 Region: 32-92
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000262
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014928   Gene: ENSNLEG00000012264   Transcript: ENSNLET00000015674
Sequence length 987
Comment pep:novel supercontig:Nleu1.0:GL397275.1:6695903:6723061:-1 gene:ENSNLEG00000012264 transcript:ENSNLET00000015674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCCCCGCCPLLAHLEQGSLRERTREKEKMKEAKDARYTNGHLFTTISVSGMTMCYACNKS
ITAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNNTALQSVSLRSKTTIRER
PSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLN
MRNRTLSVESLIDEAEVIYNELMSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDV
IYELIQTELHHVRTLKIMTRLFRTGMLEELQLEPGVVQGLFPCVDELSDIHTRFLSQLLE
RRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMRKTYSEFCSRHTKALKLYKELYARD
KRFQQFIRKVTRSAVLKRHGVQECILLVTQRITKYPVLLSRILQHSHGIEEERQDLTTAL
GLVKELLSNVDQDIYELEKGARLQEIYNRMDPRAQTPVPGKGPFGREELLRRKLIHDGCL
LWKTATGRFKDVLMLLMTDVLLFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMF
LISAAPPEMYEVHTASRDDRSTWIRVIQQSVRICPSREDFPLIETEDEAYLRRIKMELQQ
KDRALVELLREKVGLFAEMTHFQAEEDGGSGMALPTLPRGLFRSESLESPRGERLLQDAI
REVEGLKDLLVGPGVELLLTPREPALPLEPDSGGNTSPGVTANGEARTFNGSIELCRADS
DSSQRDRNGNQLRSPQEEALQRLVNLYGLLHGLQAAVAQQDTLMEARFPEGPEWREKLCR
ANSRDGEAGRAGAAPVVPEKQATELALLQRQHALLQEELRRCRRLGEERATEAGSLEARL
RESEQARALLEREAEEARRQLAALGQTEPLPAEAPWARRPVDPRRRSLPAGDALYLSFNP
PQPSRGTDRLDLPVTTRSVHRHFEDRERQELGSPEERLQDSSDPDTGSEEEGSSRLSPPH
SPRDFTRMQDIPEETESRDGEAVASES
Download sequence
Identical sequences ENSNLEP00000014928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]