SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015077 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015077
Domain Number 1 Region: 42-205
Classification Level Classification E-value
Superfamily Cyclophilin-like 6.43e-54
Family Cyclophilin (peptidylprolyl isomerase) 0.000000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015077   Gene: ENSNLEG00000012419   Transcript: ENSNLET00000015832
Sequence length 215
Comment pep:novel supercontig:Nleu1.0:GL397307.1:7749000:7755864:-1 gene:ENSNLEG00000012419 transcript:ENSNLET00000015832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDLRIGDEDVGRV
IFGLFGKTVPKTVDNFVALATGEVSGWSRGKFSRSVAWTSLTEHRLPVVLGTQGQSIYGE
RFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRK
VESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE
Download sequence
Identical sequences ENSNLEP00000015077 ENSNLEP00000015077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]