SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015146 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015146
Domain Number 1 Region: 433-472,505-565
Classification Level Classification E-value
Superfamily PUA domain-like 1.39e-24
Family Hypothetical protein TTHA0113 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015146   Gene: ENSNLEG00000012455   Transcript: ENSNLET00000015903
Sequence length 581
Comment pep:novel supercontig:Nleu1.0:GL397307.1:8029109:8101086:1 gene:ENSNLEG00000012455 transcript:ENSNLET00000015903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAGAVSGEPLVHWCTQQLRKTFGLDVSEEIIQYVLSIESAEEIQEYVTDLLQGNEGKK
GQFIEELITKWQKNDQELISDPLQQCFKKDEILDGQKSGDHLKRGRKKGRNRQEVPAFTE
PDMTAEVKTPFDLAKAQENSNSVKKKTKFVNLYTREGQDRLAVLLPGRHPCDCLGQKHKL
INNCLICGRIVCEQEGSGPCLFCGTLVCTHEEQDILQRDSNKSQKLLKKLMSGVENSGKV
DIYTKDLLPHQELRIKSGLEKAIKHKDKLLEFDRTSIRRTQVIDDESDYFASDSNQWLSK
LERETLQKREEELRELRHASRLSKKVTIDFAGRKILEEENSLAEYHSRLDETIQAIANGT
LNQPLTKLDRSSEEPLGVLVNPNMYQSPPQWVDYTGAASQKKAFRSSGLGLEFNSFQHQL
RIQDQEFQEGFDGGWCLSIHQPWASLLVRGIKRVEGRSWYTPHRGRLWIAATAKKPSPQE
VSELQATYRLLRGKDVEFPNDYPSGCLLGCVDLIDCLSQKQFKEQFPDISQESDSPFVFI
CKNPQEMVVKFPIKGNPKIWKLDSKIHQGAKKGLMKQNKAV
Download sequence
Identical sequences G1RPI2
XP_004093146.1.23891 ENSNLEP00000015146 ENSNLEP00000015146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]