SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015335 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015335
Domain Number 1 Region: 576-664
Classification Level Classification E-value
Superfamily PH domain-like 9.96e-19
Family Third domain of FERM 0.005
Further Details:      
 
Domain Number 2 Region: 383-476
Classification Level Classification E-value
Superfamily PH domain-like 2.8e-17
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 
Domain Number 3 Region: 273-324
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000798
Family Second domain of FERM 0.011
Further Details:      
 
Domain Number 4 Region: 524-575
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000707
Family Second domain of FERM 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000015335
Domain Number - Region: 16-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00887
Family Ubiquitin-related 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015335   Gene: ENSNLEG00000012599   Transcript: ENSNLET00000016111
Sequence length 687
Comment pep:novel supercontig:Nleu1.0:GL397312.1:3553925:3654885:-1 gene:ENSNLEG00000012599 transcript:ENSNLET00000016111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALDGIRMPDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSD
HALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVF
KAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGSIYS
SPGLYSKTMTPTYDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPEILAKMFKPQ
ALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSFFDLNPKYDAIRINQLYEQAKW
AILLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAALSDLEITLEGG
KTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQ
MNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTM
ADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDINPECLVSPRYLKKYKNKQPGYVRD
LITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELIGIAYNRL
IRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGY
IFLSTRAKDQNESLDEEMFYKLTSGWV
Download sequence
Identical sequences A0A2K5IXR5 A0A2K5M7M2 A0A2K6A550 A0A2K6M1V3 A0A2K6P5N1 G1RQ21 G7MXX4 G7PAA0
ENSNLEP00000015335 ENSNLEP00000015335 XP_003267751.1.23891 XP_005561333.1.63531 XP_006872422.1.41390 XP_007984906.1.81039 XP_010370369.1.97406 XP_011817199.1.43180 XP_011817200.1.43180 XP_011855106.1.47321 XP_011855107.1.47321 XP_011917231.1.92194 XP_017704987.1.44346 XP_021590742.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]