SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015393 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015393
Domain Number 1 Region: 32-74,183-465
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.76e-54
Family NOL1/NOP2/sun 0.00056
Further Details:      
 
Domain Number 2 Region: 115-187
Classification Level Classification E-value
Superfamily PUA domain-like 0.0000000603
Family Hypothetical RNA methyltransferase domain (HRMD) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015393   Gene: ENSNLEG00000012680   Transcript: ENSNLET00000016179
Sequence length 469
Comment pep:novel supercontig:Nleu1.0:GL397271.1:17260641:17348084:-1 gene:ENSNLEG00000012680 transcript:ENSNLET00000016179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPPSFTTVRVNTH
LASVQHVKNLLLDELQKQFNGLSVPILQHPDLQDVLLIPVIGPRKNIKKQQCEAIVGAQC
GNAVLRGAHVYAPGIVSASKFMKAGDVISVYSDIKGKCKKGAKEFDGTKVFLGNGISELS
RKEIFSGLPELKGMGIRMTEPVYLSPSFDNVLPRYLFLQNLPSALVTHVLNPQPGEKILD
LCAAPGGKTTHIAALMHDQGEVIALDKIFNKVEKIKQNALLLGLNSIRAFCFDGTKAVKL
DIVEDTEGEPPFLPESFDRILLDAPCSGMGQRPNMACTWSLKEVASYQPLQRKLFTAAVQ
LLKPEGVLVYSTCTITLAENEEQVAWALTKFPCLRLQPQEPQIGGEGMRGAGLSCEQLKQ
LQRFDPSAVPLPDTDVDSLREARREDMLRLANKDSIGFFIAKFVKCKST
Download sequence
Identical sequences G1RQ79
ENSNLEP00000015393 ENSNLEP00000015393 XP_003257743.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]