SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015860 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015860
Domain Number 1 Region: 617-681,886-1226
Classification Level Classification E-value
Superfamily Ras GEF 7.59e-118
Family Ras GEF 0.0000128
Further Details:      
 
Domain Number 2 Region: 216-439
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.27e-43
Family DBL homology domain (DH-domain) 0.00025
Further Details:      
 
Domain Number 3 Region: 15-124
Classification Level Classification E-value
Superfamily PH domain-like 5.03e-18
Family Pleckstrin-homology domain (PH domain) 0.0076
Further Details:      
 
Domain Number 4 Region: 427-582
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000254
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015860   Gene: ENSNLEG00000013038   Transcript: ENSNLET00000016670
Sequence length 1229
Comment pep:novel supercontig:Nleu1.0:GL397283.1:13442451:13710240:1 gene:ENSNLEG00000013038 transcript:ENSNLET00000016670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGHALYLAFLARKEGTKRGFLSKKTAEASRWHEKWFALYQNVLFYFEGEQSCRPAGMYLL
EGCSCERTPAPPRAGAGPGGVRDALDKQYYFTVLFGHEGQKPLELRCEEEQDGKEWMEAI
HQASYADILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKSEIIALNKT
KERMRPYQSNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAESMRKRNQIV
FTMVEAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHEIFHQ
GLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYEA
NPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSRVMHD
EVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKVRLGSLSLK
KEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIDCTLIEEPDASDDDSKGSGQVFG
HLDFKIVVEPPDAAAFTVVLLAPSRQEKAAWMSDISQCVDNIRCNGLMTIVFEENSKVTV
PHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFLNTFLHT
YRIFTTAAVVLGKLSDIYKRPFTSIPVRSLELFFATSQNNRGEHLVDGKSPRLCRKFSSP
PPLAVSRTSSPVRARKLSLTSPLNSKIGALDLTTSSSPTTTTQSPAASPPPHTGQIPLDL
SRGLSSPEQSPGSVEENVDNPRVDLCNKLKRSIQKAVLESAPADRAGVESSPAADTTELS
PCRSPSTPRHLRYRQPGGQTADNAHCSVSPASAFAIATAAAGHGSPPGFNNTERTCDKEF
IIRRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLPQERKATANIL
RALSQDDQDDIHLKLEDIIQMTDCMKAECFESLSAMELAEQITLLDHVIFRSIPYEEFLG
QGWMKLDKNERTPYIMKTSQHFNDMSNLVASQIMNYADVSSRANAIEKWVAVADICRCLH
NYNGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLRETLKNCNP
PAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTSYRIDHQPKV
TQYLLDKDLIIDEDTLYELSLKIEPRLPA
Download sequence
Identical sequences ENSNLEP00000015860 ENSNLEP00000015860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]