SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015960 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015960
Domain Number 1 Region: 79-217
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-29
Family DBL homology domain (DH-domain) 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015960   Gene: ENSNLEG00000013162   Transcript: ENSNLET00000016775
Sequence length 219
Comment pep:novel supercontig:Nleu1.0:GL397271.1:26279410:26363774:-1 gene:ENSNLEG00000013162 transcript:ENSNLET00000016775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPKEATGKENMVTKKKNLAFLRSRLYMLERRKTDTVVESSVSGDHSGTLRRSQSDRTEY
NQKLQEKMTPQSECSVAETLTPEEEHQMKRMMAKREKIIKELIQTEKDYLNDLELCLREV
VQPLRNKKIDRLDVDSLFSNIESVHQISAKLLSLLEEATTDVEPAMQVIGEVFLQIKGPL
EDIYKIYCYHHDEAHSILESYEKEEELKEHLSHCIQSLK
Download sequence
Identical sequences G1RRU2
ENSNLEP00000015960 ENSNLEP00000015960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]