SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016042 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016042
Domain Number 1 Region: 31-324
Classification Level Classification E-value
Superfamily RNI-like 1.49e-37
Family 28-residue LRR 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016042   Gene: ENSNLEG00000013247   Transcript: ENSNLET00000016862
Sequence length 379
Comment pep:novel supercontig:Nleu1.0:GL397458.1:99161:104614:1 gene:ENSNLEG00000013247 transcript:ENSNLET00000016862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSLPASCLLAQAVIACGNVKMKHVPALTDPGLTTLYLAENEIAKIPAHTFLGLPNLEWL
DLSKNKLDPRGLHPHAFKNLMQLKRLNLDGNSLTTVPALPASLQELKLNDNLLQGLQRSS
FRGAGEFRGQGPRGPGLXXXXXXMAFQPLCSLLYLRLDRNRLRTIPRGLPASLQELHLGT
NLIEEVVEGALSHIHSLSVLVLSHNRLQEHRLAPRAWIHLPRLETLDLSYNRLVRVPSFL
PRGLRRLMLHHNHIERIPGYAFAHMKPGLEFLHLSHNRLQADGIHSVLRASLAELLLDHN
QLQAIPRGLLGLKGLQVPGLSHNRIRQVPLNSICDTRVARDSNLISTHLENNLIDRHRIP
PTAFSCIRAYHSVVLQPQQ
Download sequence
Identical sequences ENSNLEP00000016042 ENSNLEP00000016042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]