SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016141 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016141
Domain Number 1 Region: 202-345
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.94e-44
Family Dual specificity phosphatase-like 0.00000101
Further Details:      
 
Domain Number 2 Region: 7-139
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 9.47e-20
Family Cell cycle control phosphatase, catalytic domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016141   Gene: ENSNLEG00000013321   Transcript: ENSNLET00000016965
Sequence length 383
Comment pep:novel supercontig:Nleu1.0:GL397458.1:270590:274051:1 gene:ENSNLEG00000013321 transcript:ENSNLET00000016965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGLGRSCLWLRRELSPPRPRLLLLDCRSRELYESARIGGALSVALPALLLRRLRRGSLS
VRALLPGPPLQPPPPAPVLLYDQGGGRRRRGEAEAEEEWEAESVLGTLLQKLREEGYLAY
YLQGGFSRFQAECPHLCETSLGGRAGSSMAPVPSPVPVVGLGSLCLGSDCSDAESEADRD
SMSCGLDSEGATPPPVGLRASFPVQILPNLYLGSARDSANLESLAKLGIRYILNVTPNLP
NFFEKNGDFHYKQIPISDHWSQNLSQFFPEAIEFIDEALSQNCGVLVHCLAGVSRSVTVT
VAYLMQKLHLSLNDAYDLVKRKKSNISPNFNFMGQLLDFERSLRLEERRSQEQGRGGQAS
AASNPPSFFTTPTSDGAFELAPT
Download sequence
Identical sequences G1RSB9
ENSNLEP00000016141 ENSNLEP00000016141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]