SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016244 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016244
Domain Number 1 Region: 218-377
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.51e-45
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000748
Further Details:      
 
Domain Number 2 Region: 116-214
Classification Level Classification E-value
Superfamily LCCL domain 2.75e-25
Family LCCL domain 0.00082
Further Details:      
 
Domain Number 3 Region: 3-112
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-25
Family Spermadhesin, CUB domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016244   Gene: ENSNLEG00000013410   Transcript: ENSNLET00000017076
Sequence length 678
Comment pep:novel supercontig:Nleu1.0:GL397266.1:9127133:9182610:1 gene:ENSNLEG00000013410 transcript:ENSNLET00000017076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDGCGHLVTYQDSGTMTSKNYPGTYPNHTVCEKTITVPKGKRLILRLGDLDIESQTCASD
YLLFTSSSDQYGPYCGSMTVPKELLLNTSEVTVRFESGSHISGRGFLLTYASSDHPDLIT
CLERASHYLKTEYSKFCPAGCRDVAGDISGNMVDGYRDTSLLCKAAIHAGIIADELGGQI
SVLQRKGISRYEGILANGVLSRDGSLSDKRFLFTSNGCSRSLSLEPDGQIRASSSWQSVN
ESGDQVHWSPGQARLQDQGPSWASGDSSNNHKSREWLEIDLGEKKKITGIRTTGSTQSNF
NFYVKSFVMNFKNNNSKWKTYKGIVNNEEKVFQGNSNFRDPVQNNFIPPIVARYVRVVPQ
TWHQRIALKVELIGCQITQGNDSLVWRKTSQSTSVSTKKEDETITRPVPSEETSTGINIT
TVAIPLVLLVVLVFAGMGIFAAFRKKKKKGSPYGSAEAQKTDCWKQIKYPFARHQSAEFT
ISYDNEKEMTQKLDLITSDMADYQQPLMLGTGTVTRKGSTFRPMDTDAEEAGVSTDAGGH
YDCPQRAGRHEYALPLAPPEPEYATPIVERHLLRAHTFSAQSGYRVPGPQPGHKHSLSSG
GFSPVAGVGAQNGDYQRPHSAQPADRGYDRPKAASAFTTESGHPDSQKPPTHPGTSDSYS
APRDCLTPLNQTAMTALL
Download sequence
Identical sequences ENSNLEP00000016244 ENSNLEP00000016244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]