SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016342 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016342
Domain Number 1 Region: 881-1064
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-47
Family DBL homology domain (DH-domain) 0.00000027
Further Details:      
 
Domain Number 2 Region: 1050-1203
Classification Level Classification E-value
Superfamily PH domain-like 1.61e-47
Family Pleckstrin-homology domain (PH domain) 0.00000192
Further Details:      
 
Domain Number 3 Region: 751-843
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-21
Family SH3-domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016342   Gene: ENSNLEG00000013485   Transcript: ENSNLET00000017181
Sequence length 1271
Comment pep:novel supercontig:Nleu1.0:GL397353.1:3148385:3229208:1 gene:ENSNLEG00000013485 transcript:ENSNLET00000017181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTQAAVRPWAPCLENMTTVPNGLGPGPAAPCPGSDLKDPKMVTSLACGNGVCGCSPGGNT
DTQEAKLSPAKLVRLFSTGRKRTGAHPERPRSVVLVGNSSAWNTLASFRKMGSFKKLKSS
VLKGIQSREGSNACSKGEALEHGLGKSIPNGTVPGAQASRASPSAPGPACGALRPAEWGT
LDGSDLEDTDDAFQRSTHRSRSLRRAYGLGRICLLDAPQNHATPTIATGQVAAMCEILVR
DPENNSMGYRRSKSTDNLAFLKKSSFKRKSTSNLADLRTAHDAQVPQRTLSSSSTDSQKL
GSGRTKRWRSPIRAKDFDRVFKLVSNVTEAAWRRESPRSGAPSPGEASLRLQAHSQLHDD
YSRRVSRSTEQDSRWGGTVMHGTTAACTVVPGFGSATSKGPHLDTDTAVFPLEAKSSWAV
ESDSSCTGSSSPSPIVQDVLSKDSCDPNAGSQLTFDPEQPPTPLRPTTPKPQSPQSPGAA
SANCHSNHSALSANSEESEGRAEEPAQREPGPVSLQDPLEATHGDEGSKDLLVNVGVAAG
PEEKEKEEVVPDGPWRRGSSQDEERTEAQRTPKRRWGSGRRPRPRPFSDYGQLASRSLSI
PEDSVAADPQKEDRVDEDPQASMTSASPEDQNAPVGCPKGARRRRPISVIGGVSLYGTNQ
TEELDNLLTQPASRPPMPAHQVPPYKAVSARFRPFTFSQSTPIGLDRVGRRRQMRASNIS
SDGGTEPSALVDDNGSEEDFSYEDLCQASPRYLQPGGEQLAINELISDGNVVCAEALWDH
VTMDDQELGFKAGDVIQVLEASNKDWWWGRSEDKEAWFPASFVRVRVLQDPFSHGSTMAS
SETHRVSLIKIHSKFMALGLQKLYYSNNLFGFPNKKYYFCILQGYIRQCRKHTGMFTVAQ
LATIFGNIEDIYKFQRKFLKDLEKQYNKEEPHLSEIGSCFLQNQEGFAIYSEYCNNHPGA
CLELANLMKQGKYRHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTTQEH
GDYSNIKAAYEAMKNVACLINERKRKLESIDKIARWQVSIVGWEGLDILDRSSELIHSGE
LTKITKQGKSQQRTFFLFDHQLVSCKKDLLRRDMLYYKGRLDMDEMEVVDLGDGRDKDYN
LSVKNAFKLVSRTTDEVYLFCAKKQEDKARWLQACADERRRVQEDKEMGMEISENQKKFA
MLNAQKAGHGKSKGYNRCPVAPPHQGLHPIHQRHITMPTSIPQQQVFGLAEPKRKPSLFW
HTFNRLTPFRK
Download sequence
Identical sequences ENSNLEP00000016342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]