SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016416 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016416
Domain Number 1 Region: 3-44,81-149
Classification Level Classification E-value
Superfamily PUA domain-like 2.14e-19
Family Hypothetical protein TTHA0113 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016416   Gene: ENSNLEG00000013524   Transcript: ENSNLET00000017258
Sequence length 158
Comment pep:novel supercontig:Nleu1.0:GL397341.1:6581649:6588294:-1 gene:ENSNLEG00000013524 transcript:ENSNLET00000017258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFGCLSFRQPYAGFVLNGVKTVETRWRPLLSSQRNCTIAIHIAHRDWEGDAWRELLVER
FGMTPAQIQALLREGEKFGRGVIAGLVDIGETLQCPEDLTPDEVVELENQAVLTNLKQKY
LTVISNPRWLLEPIPRKGGKDVFQVDIPEHLIPLGHEV
Download sequence
Identical sequences A0A2I3HU39
ENSNLEP00000016416 ENSNLEP00000016416 XP_003271885.2.23891 XP_004092596.1.23891 XP_004092597.1.23891 XP_004092598.1.23891 XP_012354480.1.23891 XP_012354481.1.23891 XP_012354482.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]