SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016481 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016481
Domain Number 1 Region: 205-291
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000294
Family Rna1p (RanGAP1), N-terminal domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016481   Gene: ENSNLEG00000013614   Transcript: ENSNLET00000017325
Sequence length 334
Comment pep:novel supercontig:Nleu1.0:GL397330.1:437022:452579:1 gene:ENSNLEG00000013614 transcript:ENSNLET00000017325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLDIHSAQVPLPGGRGRHRDATPESKGSLQDLGWSAVAQSQLTATSISPAQVIPPPQPHE
RWSRTPGFKRYSCLGLHKVLGSQSLRLVAPMWNGRIRGIHRLGGAVAPEGNQKKERTILQ
FLANYFYDVEALRDYLLQREMYKVHKKNRSYTWLEKQHGPYGAGAFFILKQGGAVKFRDK
EWIRPDKYGHFSQEFWNFREVPVEAVDASDCDINYEGLDNLLLLKELQSLSLQRCSHVDD
WCLSRLYPLADSLQELSLAGCPRVSERGLACLHHLQNLRRLDISDLPAVSNPGLTQILVE
EMLPNCKVVGVDWAEGLKSALEEQPQDTASPVPA
Download sequence
Identical sequences ENSNLEP00000016481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]