SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016533 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016533
Domain Number 1 Region: 328-605
Classification Level Classification E-value
Superfamily RNI-like 2.55e-38
Family Cyclin A/CDK2-associated p19, Skp2 0.0073
Further Details:      
 
Domain Number 2 Region: 265-335
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000144
Family F-box domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016533   Gene: ENSNLEG00000013629   Transcript: ENSNLET00000017379
Sequence length 621
Comment pep:novel supercontig:Nleu1.0:GL397273.1:33679512:33750006:-1 gene:ENSNLEG00000013629 transcript:ENSNLET00000017379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPVFPMLTVLTMFYYICLRRRARTATRGEMMNSHRTIESNSRTSPLNAEVVQYAKEVVD
FSSHYGSENSMSYTMWNLAGVPNVFPSSGDFTQTAVFRTYGTWWDQCPSASLPFKRTPPN
FQSQDYVELTFEQQVYPTAVHVLETYHPGAVIRILACSANPYSPNPPAEVRWEILWSERP
TKVNASQARQFKPCIKQINFPTNLIRLEVNSSLLDYYTELDAVVLHGVKDKPVLSLKTSL
IDMNDIEDDAYEEKDGCGMDSLNKQFSSAVLREGPNNGYFDKLPYELIQLILNHLTLPDL
CRLAQTCKLLSQHCCDPLQYIHLNLQPYWAKLDDTSLEFLQSRCTLVQWLNLSWTGNRGF
ISVAGFSRFLKVCGSELVRLELSCSHFLNEACLEVISEMCPNLQALNLSSCDKLPPQAFN
HIAKLCSLKRLVLYRTKVEQTALLSILNFCSELQHLSLGSCVMIEDYDVIASMIGAKCKK
LRTLDLWRCKNITENGIAELASGCPLLEELDLGWCPTLQSSTGCFTRLARQLPNLQKLFL
TANRSVCDTDIEELACNCTRLQQLDILGTRMVSPASLRKLLESCKDLSLLDVSFCSQIDN
RAVLELNATFPKVFIKKSFTQ
Download sequence
Identical sequences G1RTF9
ENSNLEP00000016533 XP_003258410.1.23891 XP_003258411.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]