SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016563 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016563
Domain Number 1 Region: 360-688
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 7.19e-55
Family Diacylglycerol kinase-like 0.01
Further Details:      
 
Domain Number 2 Region: 912-1036
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.38e-19
Family Ankyrin repeat 0.001
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000016563
Domain Number - Region: 155-212
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00785
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016563   Gene: ENSNLEG00000013659   Transcript: ENSNLET00000017410
Sequence length 1051
Comment pep:novel supercontig:Nleu1.0:GL397282.1:27948114:28480846:-1 gene:ENSNLEG00000013659 transcript:ENSNLET00000017410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPQRSRPARARLGSWGAGIEVPPCSGCACSPSYSAGGSMNPSSSAGEEKAATGGSSSSGS
GAGSCCLGAESGADPRGAGAAAAAGAAALDEPAAAGQKEKDEALEEKLRNLTFRKQVSYR
KAISRAGLQHLAPAHPLSLPVANGPAKEPRATLDWSENAVNGEHLWLETNVSGDLCYLGE
ENCQVRFAKSALRRKCAVCKIVVHTACIEQLEKINFRCKPTFREGGSRSPRENFVRHHWV
HRRRQEGKCKQCGKGFQQKFSFHSKEIVAISCSWCKQAFHNKVTCFMLHHIEEPCSLGAH
AAVIVPPTWIIKVKKPQNSLKASNRKKKRTSFKRKASKRGMEQENKGRPFVIKPISSPLM
KPLLVFVNPKSGGNQGTKVLQMFMWYLNPRQVFDLSQEGPKDALELYRKVPNLRILACGG
DGTVGWILSILDELQLSPQPPVGVLPLGTGNDLARTLNWGGGYTDEPVSKILCQVEDGTI
VQLDRWNLHVERNPDLPPEELEDGVCKLPLNVFNNYFSLGFDAHVTLEFHESREANPEKF
NSRFRNKMFYAGAAFSDFLQRSSRDLSKHVKVVCDGTDLTPKIQELKFQCIVFLNIPRYC
AGTMPWGNPGDHHDFEPQRHDDGYIEVIGFTMASLAALQVGGHGERLHQCREVMLLTYKS
IPMQVDGEPCRLAPAMIRISLRNQANMVQKSKRRTSMPLLNDPQSVPDRLRIRVNKISLQ
DYEGFHYDKEKLREASISDWLRTIAGELVQSFGAIPLGILVVRGDCDLETCRMYIDRLQE
DLQSVSSGSQRVHYQDHETSFPRALSAQRLSPRWCFLDDRSQEHLHFVMEISQDEIFILD
PDMVVSQPAGTPPGMPDLVVEQASGISDWWNPALRKRMLSDSGLGMIAPYYEDSDLKDLS
HSRVLQSPVSSEDHAILQAVIAGDLMKLIESYKNGGSLLIQGPDHCSLLHYAAKTGNGEI
VKYILDHGPSELLDMADSETGETALHKAACQRNRAVCQLLVDAGASLRKTDSKGKTPQER
AQQAGDPDLAAYLESRQNYKVIGHEDLETAV
Download sequence
Identical sequences ENSNLEP00000016563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]