SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016791 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016791
Domain Number 1 Region: 142-692,868-1063
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.48e-253
Family Motor proteins 0.00000000247
Further Details:      
 
Domain Number 2 Region: 2128-2316
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.0000577
Further Details:      
 
Domain Number 3 Region: 16-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.65e-16
Family Ras-binding domain, RBD 0.0087
Further Details:      
 
Domain Number 4 Region: 2062-2121
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000359
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0061
Further Details:      
 
Domain Number 5 Region: 1062-1129
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000682
Family Motor proteins 0.022
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000016791
Domain Number - Region: 1112-1165
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00345
Family Motor proteins 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016791   Gene: ENSNLEG00000013824   Transcript: ENSNLET00000017643
Sequence length 2619
Comment pep:novel supercontig:Nleu1.0:GL397307.1:15737082:16028592:-1 gene:ENSNLEG00000013824 transcript:ENSNLET00000017643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNINDGGRRRFEDNEHTLRIYPGTISEGTIYCPIPARKNSTAAEVIESLINKLHLDKTKC
YVLAEVKEFGGEEWILNPTDCPVQRMMLWPRMALENRLSGEDYRFLLREKNLDGSIHYGS
LQSWLRVTEERRRMMERGFLPQPQQKDFDDLCSLPDLNEKTLLENLRNRFKHEKIYTYVG
SILIVINPFKFLPIYNPKYVKMYDNHQLGKLEPHIYAVADVAYHAMLQRKKNQCIVISGE
SGSGKTQSTNFLIHHLTALSQKGFASGVEQIILGAGPVLEAFGNAKTAHNNNSSRFGKFI
QVNYQETGTVLGAYVEKYLLEKSRLVYQEHNERNYHVFYYLLAGASEDERSAFHLKQPEE
YHYLNQITKKPLRQSWDDYCYDSEPDCFTVEGEDLRHDFERLQLAMEMVGFLPKTRRQIF
SLLSAILHLGNICYKKKTYRDDSIDICNPEVLPIVSELLEVKEEMLFEALVTRKTVTVGE
KLILPYKLAEAVTVRNSMAKSLYSALFDWIVFRINHALLNSKDLEHNTKTLSIGVLDIFG
FEDYESNSFEQFCINFANERLQHYFNQHIFKLEQEEYRTEGISWHNIDYIDNTCCINLIS
KKPTGLLHLLDEESNFPQATNQTLLDKFKHQHEDNSYIEFPAVMEPAFIIKHYAGKVKYG
VKDFREKNTDHMRPDIVALLRSSKNAFISGMIGIDPVAVFRWAILRAFFRAMVAFREAGK
RNIHRKTGHDDTAPCAILKSMDSFSFLQHPVHQRSLEILQRCKEEKYSITRKNPRTPLSD
LQGMNALNEKNQHDTFDIAWNGRTGIRQSRLSSSTSLLDKDGIFANSTSSKLLERAHGIL
TRNKNFKSKPALPKHLLEVNSLKHLTRLTLQDRITKSLLHLHKKKKPPSISAQFQASLSK
LMETLGQAEPYFVKCIRSNAEKLPLRFNDALVLRQLRYTGMLETVRIRQSGYSSKYSFQD
FVSHFHVLLPRNIIPSKFNIQDFFRKINLNPDNYQVGKTMVFLKEQERQHLQDLLHQEVL
RRIILLQRWFRVLLCRQHFLHLRQASVIIQRFWRNYLNQKQVRDAAVQKDAFVMASAAAL
LQASWRAHLERQRYLELRAAAIVIQQKWRDHYRRRHMAAICIQARWKAYRESKRYQEQRK
KIILLQSTCRGFRARQRFKALKEQRLRETKSEVALVNIKGYGSLEIQGSDPSEWEDCSFD
NRIKAIEECKCLIESNRISHESSVDCLKESPNKQQERAQSQSGVVLQEDVLVRERPRSLE
DLQQKKVGRAKRESRRMRELEQAIFSLELLKVRSLGGVSPSEDRRWSTELVPEGLQSPRG
TPDSESSQGSLELLSYEESQKSKLESVISDEGDLQFPSPKISSSPKFDSRDNALSASNET
SYAEHLKDGTMKEKVVCSSESITCKPQLKDSFISSSLPTFFYIPQQDPLKTNSQLDTSIQ
RNKLLENEDTPGEALTLDINRETRRYHCSGKDQIVPSLNTESSNPVLKKLEKLNTEKEER
QKQLQQQNEKEMMEQIRQQTDILEKERKAFKTIEKPRIGECLVAPSSYQSKQRVERPSSL
LSLNTSNKGELNVLGSLSVKDAALAPKDSSSTHLTPKDRPVTVFFERKGSPCQSSTVKEL
SKTDRMGTQLNVACKLSNNRISKREHFRPTQSYGHNSDDLSREGNTRPIFFTPKDNMSIP
LVSKEALNSKNPQLRKEDEPAWKPVKLAGPGQREVARPAHKKKARMARTRSDFLTRGTFA
DGEGDTEEDDYDDIIEPLLSLDQASHCELGPAPSLGQASHSDSEMTSQRFSSVDEQAKLH
KTMSQGEITKLAVRQKASDSDIRPQRAKMRFWAKGKQGEKKTTRVKPTTQSEVSPLFAGT
DVIPAHQFPDELAPYHPTPPLSPELPSSCRKEFKENKEPSPKAKRKRSVKISNVALDSMH
WQNDSVQIIASVSDLKSMDEFLLKKVNDLDNEDSKKDTLVDVVFKKALKEFRQNIFSFYS
SALAMDDGKSIRYKDLYALFEQILEKTMRLEQRDSLGESPVRVWVNTFKVFLDEYMNEFK
TSDCTATKVPKTERKKRRKKETDLVEEHNGHIFKATQYSIPTYCEYCSSLIWIMDRASVC
KLCKYACHKKCCLKTTAKCSKKYDPELSSRQFGVELSRLTSEDRTVPLVVEKLINYIEMH
GLYTEGIYRKSGSTNKIKELRQGLDTDAESVNLDDYNIHVIASVFKQWLRDLPNPLMTFE
LYEEFLRAMGLQERKETIRGVYSVIDQLSRTHLNTLERLIFHLVRIALQEDTNRMSANAL
AIVFAPCILRCPDTTDPLQSVQDISKTTTCVELIVVEQMNKYKARLKDISSLEFAENKAK
TRLSLIRRSMGKGRIRRGNYPGPSSPVVVRLPSVSDVSEETLASEAAMETDITEQQQAAM
QQEERVLTEQIENLQKEKEELTFEMLVLEPRASDDETLESEASIGTADSSENLNMESECA
ISEKSERSLAFSSLKTAGKSEPSSKLQKQLKKQQDSLDVVDSSVSSLCPSNTASSHGTRK
LFQIYSKSPFYRAASANEALGMEGPLGQTKFLEDKPQFISRGTFNPEKGKQKLKNVKNSP
QKTKETPEGTVMSGRRKTVDPDCTSNQQLALFGNNEFMV
Download sequence
Identical sequences ENSNLEP00000016791 ENSNLEP00000016791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]