SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016834 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016834
Domain Number 1 Region: 352-677
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-95
Family Protein kinases, catalytic subunit 0.000000012
Further Details:      
 
Domain Number 2 Region: 8-138
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.2e-26
Family PLC-like (P variant) 0.0000242
Further Details:      
 
Domain Number 3 Region: 231-298
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.78e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00051
Further Details:      
 
Domain Number 4 Region: 159-224
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.02e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016834   Gene: ENSNLEG00000013835   Transcript: ENSNLET00000017685
Sequence length 683
Comment pep:novel supercontig:Nleu1.0:GL397312.1:12163117:12403374:1 gene:ENSNLEG00000013835 transcript:ENSNLET00000017685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTK
QKTNKPTYNEEFCANVTDGGHLELAVFHETPLGYDHFVANCTLQFQELLRTTGASDTFEG
WVDLEPEGKVFVVITLTGSFTEATLQRDRIFKHFTRKRQRAMRRRVHQINGHKFMATYLR
QPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTACTCQNNINKVDSKIAEQRF
GINIPHKFSIHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIRCQANVAPNCGVNAV
ELAKTLAGMGLQPGNISPTSKLVSRSTLRRQGKESSKEGNGIGVNSSNRLGINNFEFIRV
LGKGSFGKVMLARIKETGDLYAVKVLKKDVILQDDDVECTMTEKRILSLARNHPFLTQLF
CCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHDKGIIYRDL
KLDNVLLDHEGHCKLADFGMCKEGICNGVTTATFCGTPDYIAPEILQEMLYGPAVDWWAM
GVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLHEDATGILKSFMTKNPTTRLGSL
TQGGEHAILRHPFFKEIDWAQLNHRQLEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDE
GHLPMINQDEFRNFSYVSPELQP
Download sequence
Identical sequences A0A2I3GF83
ENSNLEP00000016834 XP_003267821.1.23891 ENSNLEP00000016834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]