SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016877 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016877
Domain Number 1 Region: 137-264
Classification Level Classification E-value
Superfamily Second domain of FERM 1.16e-31
Family Second domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 268-369
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-25
Family Third domain of FERM 0.0032
Further Details:      
 
Domain Number 3 Region: 48-99
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000517
Family Ras-binding domain, RBD 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016877   Gene: ENSNLEG00000013906   Transcript: ENSNLET00000017731
Sequence length 1663
Comment pep:novel supercontig:Nleu1.0:GL397286.1:3743737:3801709:1 gene:ENSNLEG00000013906 transcript:ENSNLET00000017731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSPKSAFISAAKKAKLRSNPVKVRFSEQVAVGETDAKMMKKEALLLIPNVLKVFLENGQI
KSFTFDGRTTVKDVMVTLQDRLSLRYIEHFALVLEYAGPEQNHKFLLLQDKQPLAYVVQR
THYHGMKCLFRISFFPKDPVELLRRDPAAFEYLYIQSRNDVIRERFGMDPKPEMLLGLAA
LHIYITVSATRPSQKISLKNVEKEWGLEPFLPPSLLQGIKEKNLRKSLSQQLKAHQTHPS
CGTKGSAIQAKLQYLRILNELPTFTGVLFNTVGLDEKQSATTLLVGPRHGISHVIDLKTN
LTTVLSEFSKISKIQLFRENQGVARVETSIMDAKPLVLLMEWPEATNFACLIAGYCRLLL
DSRKMVFSRPASQPLPPPMIKADYMHSAHRPVTGGHLGKKESSYVGSVGTSPRKSSRCTP
PPADSELVSFCYLHMREQRKEQESRTDVNENLIFFEETRPRTKSDPTSKSSGQGYEVVPD
DFDAASLDHEPCASRARSYTLDNSLGAEALNFYCDSCKAKLQEQLGPRKGGKPGSSRDNI
VDLMSLPPPGNHAQELDDALVSTLQALEALAASMDNTHHPHRLQVMTDSFSLFPPPSLVQ
EGPVGCLDRVRGATIANRPWILRDNRVELEKNLISVSITSPIPVPPGLIVLATITPESSL
DSGHETNSSELTDMSEMMSAMKQHQNTTYFLAQHLNKDSLLARKDLPFRIQSCAAQAVLT
APYSLGRPDPNSSLQPIATGKSPGPPGARRKLPQSEGQVEGERTYSLAVHPALSPQLSEQ
KNLSLLSPVPEDKGPGHTRAGLEMSLRAATSSLSEEQVSELRDNLPKEVRLSPKLILDPK
GSVTPAIISAALQQVVHSKSLVTAGGALGNPPSRGERRLEASMGRPEVSMMSSSANKNLK
FKISPSAPETSRNSQHQLGAEVSSSPRAPTGSRSDSLHLSQQEDRLPVQNFPPKSYLLRT
SRESVGKQATGEAVGKGGPEGGKPTLQKQGTISSQGEKVQLESTPKRSKLEETSLVPRAT
YPIALQSPSCQSRSHSPSCQPHGHSPSSQSRGQSPSCQPRGQSPLRSQAASRQVSTMPSR
KLETTLNGAHSTSEGPAKPKSSRGPFRLRNLFSATFPTRQKKETDERQAQLQKVKQYELE
FLEELLKPPSQGELPGTEYLQPPAPGRCSCQLRSSPVQQGPGMSREQRRSCDCKRICRGG
RPQATQTPVPSLRGRERDRVLPSQRQPEAGPGVSLSSPINVRRIRSTSLESRECRSDPES
GVSCLTTCASGGECLGAPNYRKLMRRYSISELDQGDRASLTSDVYPHPPLGMLPREAKEV
ETSLPIALGPKSRSLESPTLGDPFYVQVAPETKGPRQMAVFSLPEEVYRKPAELDEDSES
SKCCSIRYCFYYRKCDMADDASDGKDELSYSIPMKILPGMKLDEQVVPVVSRTLQVLDAA
TCSSSSPEASRTQEIDLRVSTFEGSLAKINALRAHAYGLPDGFLAARLDTNELLTVLRQC
VASPEARAPKPYVSQISEYKLELALKFKELRASCRRVANVDKSPTHMLAAITGSFQVLSS
LIETFVRLVFIVRSEAQRQELLAKVEEVVRNYTFLLRAAEESTARNLNQQQQQQQQQQQQ
QQQQQQQQQVAAAAGAATEHPPGSPTSATVMSTFTHSLKTLIK
Download sequence
Identical sequences ENSNLEP00000016877 ENSNLEP00000016877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]