SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016901 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016901
Domain Number 1 Region: 1196-1946
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.35e-264
Family Motor proteins 0.0000000002
Further Details:      
 
Domain Number 2 Region: 3293-3409
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000688
Family Second domain of FERM 0.01
Further Details:      
 
Domain Number 3 Region: 2863-2946
Classification Level Classification E-value
Superfamily SH3-domain 0.000000155
Family SH3-domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000016901
Domain Number - Region: 3410-3460
Classification Level Classification E-value
Superfamily PH domain-like 0.00477
Family Third domain of FERM 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016901   Gene: ENSNLEG00000013880   Transcript: ENSNLET00000017755
Sequence length 3525
Comment pep:novel supercontig:Nleu1.0:GL397474.1:1590192:1652562:1 gene:ENSNLEG00000013880 transcript:ENSNLET00000017755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKEEDEEKKAKKGKKGKKAPEPEKPKRSLKGTSRLFMGFRDRAPKISKKGQFRSASAFF
WGLHTGPQKTKRKKKARTVLKSTSKLMTQMRMGKKKRAMKGKKPSFMVIRFPGRRGYGRL
RPRARSLSKASTAINWLTKKFLLKKAEESGSEQATVDAWLQRSSSRMGSRKLPFPSGAEI
LRPGGRLRRFPRSHSIYASGEPLGFLPFEDEAPFHHSGSRKSLYGLEGFQDLGEYYDYHR
DGDDYYDRQSLHSYQEQEPYLAGLGPYSPAWPPYSDHYYGYPPVDPYDYYHPDYYSGPFD
PGYTYGYGYDDYEPPYAPPSGYSSPYSYHDGYEGKAHPYGYYLDPYAPYDAPYPPYDLPY
HTTYDVPYFDPYGVPYTVPYAEGVYGGGDEAIYPPEVPYFYPAESASAFVYPWVPPPIPS
PHNPYAHAMDDIAELEEPEDAGGERQGTSFRLPSAAFFEQQGIDKPARSKLSLIRKFRLF
PRPQVKLFGKEKLEVPLPPSLDIPLPLGDVDEEEDEEELPPVSAVPYGHPFWGFLTPRQR
NLQRALSAFGAHRGLGFGPEFGRPAPRPATSLARFLKKTLSEKPIPRLRGSQKARAGGPA
VREAAYKRFGYKLAGMDPEKPGTPIVLRRAQPRARSSNDARRPPAPQPAPRTLSHWSTLL
SPPVPPRPPSPGPHPGPPLSPALSGLPRPASPYGSLRRHPPLWAAPAHVPLVPQASWWAF
VEPPAVSPEVPPDLFAFPGPRPSFRGSRRRGPAFGFPGASPRASRRRAWSPLASPHPSRR
SPPGLDYFSPLVPPSPQLSLRTGPFQPPFPPPACRPRSLQESAAPRRAAGRLGPPGSPLS
GSPRPPSPPPGLGHSRRRCSLNLPSRLPHTWRRLSEPPTRAVMPRVHPPFQRPPRAGAWG
APLEHRESPREPEDSETLWTVPPLAPSWDVDMPPTQRPPSPWPGGAGSRRGFSRPPPVPE
NPFLQLLGPVPSPTLQPEDPAADMTRVFLGRHHEPGPGQLTKSAGPTSEKPEEEATLGDP
QLPAETKRPTPTPPKDVIPPKDALPEQKTLRPSLSYPLAACDQTRATWPPWHRWGTLPQA
AAPLAPIRAPEPLPKGGERRRAVPGRFAVVMPRVQKLSSFQRVGPATLKPRVQPTQDPKL
RACSLRWSCLWLRADAYGPWPRVHTHAQSCHLGPGAACLSLRGSWEEVGPPSWRNKMHSI
RNLPSMRFREQHREDGVEDMTQLEDLQETTVLSNLKIRFERNLIYTYIGSILVSVNPYQM
FGIYGPEQVQQYNGRALGENPPHLFAIANLAFAKMLDAKQNQCIIISGESGSGKTEATKL
ILRYLAAVNQKRDVMQQVIQILEATPLLESFGNAKTVRNDNSSRFGKFMEIFLEGGVISG
AITSQYLLEKSRIVFQAKNERNYHIFYELLAGLPAQLRQAFSLQEAETYYYLNQGGNCEI
AGKSDADDFHRLLAAMEVLGFSSEDQDSIFRILASILHLGNVYFEKYETDAQEVASVVSA
REIQAVAELLQISPEGLQKAITFKVTETMREKIFTPLTVESAVDARDAIAKVLYALLFSW
LITRVNALVSPRQDTLSIAILDIYGFEDLSFNSFEQLCINYANENLQYLFNKIVFQEEQE
EYIREQIDWQEITFADNQPCISLISLKPYGILRILDDQCCFPQATDHTFLQKCHYHHGAN
PLYSKPKMPLPEFTIKHYAGKVTYQVHKFLDKNHDQVRQDVLDLFVRSRTRVVAHLFSSH
APQAAPQRLGKSSSVTRLYKAHTVAAKFQQSLLDLVEKMERCNPLFMRCLKPNHKKEPGL
FEPDVVMAQLRYSGVLETVRIRKEGFPVRLPFQGFIDRYCCLVALKHDLPANGDMCVSVL
SRLCKVMPDMYRVGVSKLFLKEHLYQLLESMREHVLNLAALTLQRCLRGFFIKRRFRSLR
HKIILLQSRARGYLARQRYQQMRRSLVKFRSLVHAYVSRRRYLKLRAEWRRQVEGARLWE
QEELSKREVVAVGHLEVPAELAGLLQAVAGLGLARKPRVAPVRTPRLQAEPRVTLPLDIN
NYPMAKFVRCHFKEPAFGMLTVPLRTPLTQLPAEHHAEAMSVFKLVLPWEGRGHIRMKDD
TYFGSLYMLQKGLAVPELRDEILAQLANQVWHNHNAHNAERGWLLLATCLSGFAPSPRFN
KYLLKFVSDYGRNGFQAVCQHRLMQAMGRAQQQGSGAARTLPPTQLEWTATYEKASMALD
IGCFNGDQFSCPVHSWSTGEEVAGDILRHRGLADGWRGWTVAMKNGVQWAELAGHDYVLD
LVSDLELLRDFPRQKSYFIVGAEGPVASRGGPKVVFGNSWDSDEDTATRPQPQEHMPKVL
DSDGYSSHNQDGTNGETEAQRGTATYQESDSLGEPAVPHRGLDCYLDSLFDPVLSYGDVD
LEKPTAIAYRMKGGGQPGGGSSSGTEDTPRRPPEPKPIPGLDASTLALQQAFIHKQAVLL
AQEMTLQAMALQQQPLSAALRSLPAEKPPAPGAQPKSVGTGPPAKPVLLRATPKPLAPAP
LAKAPRLPTKPVAAPVLAQDQASPETTSPSPELVRYSTLNSEHFPQPTQQIKNIVRQYQQ
PFRGGRPEALRKDGGKVFMKRPDPHEEALMILKGQMTHLAAAPGTQVSREAVALVKPVTS
APRPSMAPTSALPSRSLEPPEELTQTRLHRLINPSFYGYQDAPWRIFLRKEVFYPKDSYS
HPVQLDLLFRQILHDTLSEACLRISEDERLRMKALFAQNQLDTQRPLVTESVKQAVVSTA
RDTWEVYFSRIFPATGSVGTGVQLLAVSHVGIKLLRMVKGGQEAGGQLRVLRAYSFADIL
FVTMPSQNMLEFNLASEKVILFSARAHQVKTLVDDFILELKKDSDYVVAVRNFLPEDPAL
LAFHKGDIIHLQPLEPPRVGYSGGCVVRKKVVYLEELRCRGPDFGWRFGTIHGRVGRFPS
ELVQPAAAPDFLQLPTEPGRGRAAAVAAAVASAAAAQEVGRRREGPPVRARSADHGEDAL
ALPPYTMLEFAQKYFRDPQRRPQDGLRLKSKEARESRTLEDMLCFTKTPLQESLIELSDS
SLNKMATDMFLAVMRFMGDAPLKGQSDLDVLCNLLKLCRDHEVMRDECYCQVVKQITDNT
SSKQDSCQRGWRLLYIVTAYHSCSEVLHPHLTRFLQDVSRTPGLPFQGIAKACEQNLQKT
LRFGGRLELPSSIELRAMLAGRSSKRQLFLLPGGLERHLKIKTCTVALDVVEEICAEMAL
TRPEAFSEYVIFVVTNRGQHVCPLSRRAYILDVASEMEQVDGSYMLWFRRVLWDQPLKFE
NELYVTMHYNQVLPDYLKGLFSSVPASRPSEQLLQQVSKLASLQHRAKDHFYLPSVREVQ
EYIPAQLYRTTAGSTWLNLVSQHRQQTQALSPHQARAQFLGLLSALPMFGSSFFFIQSCS
NIAVPAPCILAVNHNGLNFLSTETHELMVKFPLKEIQSTRTQRPTPNSSYPYVEIALGDV
AAQRTLQLQLEQGLELCRVVAVHVENLLSAREKRLTLPPSEITLL
Download sequence
Identical sequences ENSNLEP00000016901 ENSNLEP00000016901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]