SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016947 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016947
Domain Number 1 Region: 534-746
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.63e-53
Family DBL homology domain (DH-domain) 0.00036
Further Details:      
 
Domain Number 2 Region: 227-372
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-42
Family Third domain of FERM 0.00047
Further Details:      
 
Domain Number 3 Region: 126-229
Classification Level Classification E-value
Superfamily Second domain of FERM 7.07e-28
Family Second domain of FERM 0.00011
Further Details:      
 
Domain Number 4 Region: 46-126
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.55e-21
Family First domain of FERM 0.0025
Further Details:      
 
Domain Number 5 Region: 732-779
Classification Level Classification E-value
Superfamily PH domain-like 0.000000167
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000016947
Domain Number - Region: 461-516,752-779
Classification Level Classification E-value
Superfamily PH domain-like 0.00685
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016947   Gene: ENSNLEG00000013956   Transcript: ENSNLET00000017804
Sequence length 781
Comment pep:novel supercontig:Nleu1.0:GL397447.1:2283259:2417966:1 gene:ENSNLEG00000013956 transcript:ENSNLET00000017804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEIEGTYRVLQTAGTRLGAQTPVGVSTLEPGQTLLPRMQEKHLHLRVKLLDNTMEIFDI
EPKCDGQVLLTQVWKRLNLVECDYFGLEFQNTQSYWIWLEPVKPIIRQIRRPKNVVLRLA
VKFFPPDPGQLQEEYTRYLFALQLKRDLLEERLTCADTTAALLTSHLLQSEIGDYDETLD
REHLKANEYLPGQHHCLEKILEFHQKHVGQTPAESDFQVLEIARKLEMYGIRFHMASDRE
GTKIQLAVSHMGVLVFQGTTKINTFNWSKVRKLSFKRKRFLIKLHPEVHGPYQDTLEFLL
GSRDECKNFWKICVEYHTFFRLLDQPKPKAKAVFFSRGSSFRYSGRTQKQLVDYFKDSGM
KRIPYERRHSKTHMSIRALTADLPKQSVSFPEGLRTPASPSSANAFYSLSPSTLVPAGLP
EFTGSSSSLTDPQVSYVKSPAAERSSGAVAGGPDTPSAQPLGPPVLQPGPGLSTKSPQPS
PSSRKSPLSLSPAYQVPLGPAEQGSSPLLSPVLSDAGGAGMDYEEPRHKRMPADEAYFIV
KEILATERTYLKDLEVITVWFRSAVVKEDVMPATLMTLLFSNIDPIYEFHRGFLREVEQR
LALWEGPSKAHTKGGHQRIGDVLLRNMRQLKEFTSYFQRHDEVLTELEKATKRCKKLEAV
YKEFELQKVCYLPLNTFLLKPIQRLLHYRLLLRRLCRHYTPGHHDYADCHDALKAITEVT
TTLQHILIRLENLQKLTELQRDLVGVENLIAPGREFIREGCLHKLTRKGLQQRMFFLVGS
L
Download sequence
Identical sequences ENSNLEP00000016947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]